Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

AV51642

Sigma-Aldrich

Anti-PAXIP1 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-CAGF28, Anti-CAGF29, Anti-FLJ41049, Anti-PACIP1, Anti-PAX interacting (with transcription-activation domain) protein 1, Anti-PAXIP1L, Anti-PTIP, Anti-TNRC2

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μL
356.00 CHF

356.00 CHF


Check Cart for Availability


Sélectionner une taille de conditionnement

Changer de vue
100 μL
356.00 CHF

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

356.00 CHF


Check Cart for Availability

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

74 kDa

Espèces réactives

rat, guinea pig, rabbit, horse, human, dog, bovine, mouse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... PAXIP1(22976)

Immunogène

Synthetic peptide directed towards the N terminal region of human PAXIP1

Application

Anti-PAXIP1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.

Actions biochimiques/physiologiques

PAX interacting (with transcription-activation domain) protein 1 (PAXIP1) is a nuclear protein that belongs to the paired box gene family. It is characterized by six breast cancer carboxy-terminal (BRCT) domains. PAXIP1 is involved in chromatin condensation during mitosis and maintenance of genome stability.

Séquence

Synthetic peptide located within the following region: MFDDSSDSSPEKQERNLNWTPAEVPQLAAAKRRLPQGKEPGLINLCANVP

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Ivan M Munoz et al.
Nucleic acids research, 35(16), 5312-5322 (2007-08-11)
Human (h)PTIP plays important but poorly understood roles in cellular responses to DNA damage. hPTIP interacts with 53BP1 tumour suppressor but only when 53BP1 is phosphorylated by ATM after DNA damage although the mechanism(s) and significance of the interaction of
Eun Ah Cho et al.
Molecular and cellular biology, 23(5), 1666-1673 (2003-02-18)
The Pax transactivation domain-interacting protein (PTIP) is a large nuclear protein with multiple BRCT domains that was identified on the basis of its interaction with transcription factors of the Pax and Smad families. To address the function of PTIP during

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique