Accéder au contenu
Merck
Toutes les photos(3)

Principaux documents

AV51158

Sigma-Aldrich

Anti-APOH antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-Apolipoprotein H (β-2-glycoprotein I), Anti-B2G1, Anti-BG

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μL
473.00 CHF

473.00 CHF


Check Cart for Availability


Sélectionner une taille de conditionnement

Changer de vue
100 μL
473.00 CHF

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

473.00 CHF


Check Cart for Availability

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

36 kDa

Espèces réactives

human, dog, pig, horse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... APOH(350)

Immunogène

Synthetic peptide directed towards the N terminal region of human APOH

Application

Anti-APOH antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.

Actions biochimiques/physiologiques

Apolipoprotein H (APOH; beta-2-glycoprotein I) is a phospholipid implicated in lipid metabolism, coagulation and production of antiphospholipid autoantibodies. It functions as a cofactor required for the binding of antiphospholipid antibodies present in the sera of lupus and antiphospholipid syndrome patients.

Séquence

Synthetic peptide located within the following region: LWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGAD

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Gerard Espinosa et al.
Arthritis research & therapy, 10(6), 230-230 (2008-12-19)
Antiphospholipid syndrome is diagnosed when arterial or venous thrombosis or recurrent miscarriages occur in a person in whom laboratory tests for antiphospholipid antibodies (anticardiolipin antibodies and/or lupus anticoagulant and/or anti-beta 2-glycoprotein I) are positive. Despite the strong association between antiphospho-lipid
beta 2 Glycoprotein I--a key player in the antiphospholipid syndrome.
Bianca C H Lutters et al.
The Israel Medical Association journal : IMAJ, 4(11 Suppl), 958-962 (2002-11-29)
Zeljka Vogrinc et al.
Clinical chemistry and laboratory medicine, 43(1), 17-21 (2005-01-18)
Apolipoprotein H (apoH) is considered to be a necessary cofactor for the binding of certain antiphospholipid antibodies to anionic phospholipids. Some apoH-dependent antiphospholipid antibodies also exert lupus anticoagulant (LA) activity, which seems to depend on antiphospholipid antibody epitope specificity. The

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique