Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

AV49489

Sigma-Aldrich

Anti-FAM20C (AB1) antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-DMP4, Anti-Family with sequence similarity 20, member C, Anti-RNS

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

66 kDa

Espèces réactives

rat, guinea pig, rabbit, dog, mouse, human, horse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_064608

Numéro d'accès UniProt

Q8IXL6

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... FAM20C(56975)

Description générale

FAM20C (Family with sequence similarity 20, member C) is a member of FAM20 protein family. It is distributed in several mammalian cell lines. During hematopoietic differentiation, it is expressed in hematopoietic cells.

Immunogène

Synthetic peptide directed towards the middle region of human FAM20C

Application

Anti-FAM20C (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Actions biochimiques/physiologiques

FAM20C (Family with sequence similarity 20, member C) is a secretory Golgi casein kinase involved in biomineralization, enamel formation, lipid homeostasis, wound healing, cell migration and adhesion. It has the ability to phosphorylate S-x-E/pS motifs on proteins in milk and in the extracellular matrix of bones and teeth. During enamel formation, it forms a functional complex by binding to a pseudokinase, Fam20A, which triggers extracellular protein phosphorylation within the secretory pathway. Mutations in FAM20C gene cause Raine syndrome, hypophosphatemia, hyperphosphaturia, dental anomalies, intracerebral calcifications and osteosclerosis.

Séquence

Synthetic peptide located within the following region: CFYGECSYYCSTEHALCGKPDQIEGSLAAFLPDLSLAKRKTWRNPWRRSY

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

12 - Non Combustible Liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number
QC18404

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Rechercher un(e) COA

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Exome sequencing reveals FAM20c mutations associated with fibroblast growth factor 23-related hypophosphatemia, dental anomalies, and ectopic calcification.
Rafaelsen SH, et al.
Journal of Bone and Mineral Research, 28, 1378-1385 (2013)
Hypophosphatemic osteomalacia and bone sclerosis caused by a novel homozygous mutation of the FAM20C gene in an elderly man with a mild variant of Raine syndrome.
Takeyari S, et al.
Bone, 67, 56-62 (2014)
Vincent S Tagliabracci et al.
Cell, 161(7), 1619-1632 (2015-06-20)
The existence of extracellular phosphoproteins has been acknowledged for over a century. However, research in this area has been undeveloped largely because the kinases that phosphorylate secreted proteins have escaped identification. Fam20C is a kinase that phosphorylates S-x-E/pS motifs on
Jixin Cui et al.
eLife, 4, e06120-e06120 (2015-03-20)
Although numerous extracellular phosphoproteins have been identified, the protein kinases within the secretory pathway have only recently been discovered, and their regulation is virtually unexplored. Fam20C is the physiological Golgi casein kinase, which phosphorylates many secreted proteins and is critical
Demet Nalbant et al.
BMC genomics, 6, 11-11 (2005-01-29)
Hematopoiesis is a complex developmental process controlled by a large number of factors that regulate stem cell renewal, lineage commitment and differentiation. Secreted proteins, including the hematopoietic growth factors, play critical roles in these processes and have important biological and
Afficher tous les articles scientifiques apparentés

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique