Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

AV48984

Sigma-Aldrich

Anti-PCMTD1 antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-FLJ10883, Anti-Protein-L-isoaspartate (D-aspartate) O-methyltransferase domain containing 1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μL
354.00 CHF

354.00 CHF


Date d'expédition estimée le18 avril 2025



Sélectionner une taille de conditionnement

Changer de vue
100 μL
354.00 CHF

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

354.00 CHF


Date d'expédition estimée le18 avril 2025


Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

41 kDa

Espèces réactives

mouse, guinea pig, rat, bovine, dog, human, rabbit, horse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... PCMTD1(115294)

Description générale

Mutations in Protein-L-isoaspartate (D-aspartate) O-methyltransferase domain containing 1 (PCMTD1) gene are associated with primary angle closure glaucoma (PACG).[1]

Immunogène

Synthetic peptide directed towards the middle region of human PCMTD1

Application

Anti-PCMTD1 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.

Séquence

Synthetic peptide located within the following region: TGQNTWESKNILAVSFAPLVQPSKNDNGKPDSVGLPPCAVRNLQDLARIY

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Roopam Duvesh et al.
Investigative ophthalmology & visual science, 54(8), 5624-5628 (2013-07-13)
Three loci defined by single nucleotide polymorphisms (SNPs) rs11024102 in PLEKHA7, rs3753841 in COL11A1, and rs1015213 between the PCMTD1 and ST18 genes, recently have been associated with primary angle closure glaucoma (PACG). We explored the genetic association of these SNPs

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique