Accéder au contenu
Merck
Toutes les photos(2)

Principaux documents

AV37504

Sigma-Aldrich

Anti-MKL1 antibody produced in rabbit

IgG fraction of antiserum

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μL
354.00 CHF

354.00 CHF


Check Cart for Availability


Sélectionner une taille de conditionnement

Changer de vue
100 μL
354.00 CHF

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

354.00 CHF


Check Cart for Availability

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

106 kDa

Espèces réactives

rat, mouse, human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

mouse ... MKL1(223701)

Description générale

Megakaryoblastic Leukemia-1 (MKL1, MAL, MRTF-A, BSAC) is a MRTF family transcription factor with evolutionary conserved domains required for actin-binding, homo- and heterodimerization, high-order chromatin organization and transcriptional activation. MKL1 regulates a wide range of cell processes including epithelial-mesenchymal transition (EMT); megakaryocytic differentiation and migration; neuronal network remodeling; cellular motile functions and muscle cell differentiation including cardiovascular development. It is a component of the Rho/megakaryoblastic leukemia 1 (MKL1) signaling pathway.

Spécificité

Anti-MKL1 polyclonal antibody reacts with bovine, chicken, mouse, human, and rat megakaryoblastic leukemia-1 proteins.

Immunogène

Synthetic peptide directed towards the C terminal of human MKL1

Application

Anti-MKL1 polyclonal antibody is used to tag megakaryoblastic leukemia-1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of megakaryoblastic leukemia-1 in the Rho/megakaryoblastic leukemia 1 (MKL1) signaling pathway and a variety of cell processes such as cell mobilization and the epithelial-mesenchymal transition (EMT).

Actions biochimiques/physiologiques

MKL1 transduces cytoskeletal signals and induces smooth muscle cell differentiation from undifferentiated embryonic stem cells

Séquence

Synthetic peptide located within the following region: QPLSQPGFPAPGPPAQMDLEHPPQPPFATPTSLLKKEPPGYEETVTQQPK

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Maria Carmela Filomena et al.
eLife, 10 (2021-09-25)
Myopalladin (MYPN) is a striated muscle-specific immunoglobulin domain-containing protein located in the sarcomeric Z-line and I-band. MYPN gene mutations are causative for dilated (DCM), hypertrophic, and restrictive cardiomyopathy. In a yeast two-hybrid screening, MYPN was found to bind to titin

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique