Accéder au contenu
Merck
Toutes les photos(1)

Documents

AV37106

Sigma-Aldrich

Anti-NFATC2 antibody produced in rabbit

IgG fraction of antiserum

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Numéro MDL:
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.43

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

100 kDa

Espèces réactives

mouse, human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

mouse ... NFATC2(18019)

Description générale

Nuclear factor of activated T-cells, cytoplasmic 2(NFATC2) is a DNA-binding protein with a REL-homology region (RHR) and an NFAT-homology region (NHR). Upon T cell receptor (TCR) stimulation, NFATC2 gets translocated from the cytoskeleton to the nucleus where it becomes a component of the the nuclear factors of activated T cells transcription complex. It plays a role in regulating expression of genes critical for cell cycle progression during lymphocyte activation.

Immunogène

Synthetic peptide directed towards the N terminal region of mouse NFATC2

Actions biochimiques/physiologiques

NFATC2 is a member of The NF-AT family of potent transcription factors that are essential for T cell activation

Séquence

Synthetic peptide located within the following region: MDVPEPQPDPDGGDGPGHEPGGSPQDELDFSILFDYDYLNPIEEEPIAHK

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Mauricio S Caetano et al.
FASEB journal : official publication of the Federation of American Societies for Experimental Biology, 16(14), 1940-1942 (2002-10-09)
Upon antigen stimulation, lymphocytes enter in cell cycle and proliferate, and most of the activated T cells die by apoptosis. Many of the proteins that regulate lymphocyte activation are Under the control of transcription factors belonging to the NFAT family.

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique