Accéder au contenu
Merck
Toutes les photos(3)

Principaux documents

AV35459

Sigma-Aldrich

Anti-KCNQ2 antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-Potassium voltage-gated channel, KQT-like subfamily, member 2

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μL
417.00 CHF

417.00 CHF


Date d'expédition estimée le24 mai 2025

Un anticorps recombinant, sans conservateur, est disponible pour votre cible. Essayez ZRB1299


Sélectionner une taille de conditionnement

Changer de vue
100 μL
417.00 CHF

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

417.00 CHF


Date d'expédition estimée le24 mai 2025

Un anticorps recombinant, sans conservateur, est disponible pour votre cible. Essayez ZRB1299

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

43 kDa

Espèces réactives

human, horse, dog, mouse, bovine, guinea pig, rat

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... KCNQ2(3785)

Catégories apparentées

Description générale

Potassium voltage-gated channel subfamily Q member 2 (KCNQ2) gene, which codes for voltage-gated potassium channel subunits, is mostly expressed in the brain. KCNQ2 is made up of heteromultimeric channels with six transmembrane domains (S1–S6) in each subunit. It belongs to the voltage-gated potassium channels (KCNQ) gene subfamily. KCNQ2 gene is located on human chromosome 20q13.33.

Immunogène

Synthetic peptide directed towards the middle region of human KCNQ2

Actions biochimiques/physiologiques

Potassium voltage-gated channel subfamily Q member 2 (KCNQ2) plays a vital role in neurodevelopment. Mutations in the KCNQ2 gene are associated with benign familial neonatal infantile seizures (BFNIS), benign familial neonatal convulsions (BFNC), benign familial infantile seizures (BFIS), and neonatal onset epileptic encephalopathy (EE).

Séquence

Synthetic peptide located within the following region: GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYI

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Inn-Chi Lee et al.
Molecular genetics & genomic medicine, 7(7), e00816-e00816 (2019-06-15)
Epilepsy caused by a KCNQ2 gene mutation usually manifests as neonatal seizures during the first week of life. The genotypes and phenotypes of KCNQ2 mutations are noteworthy. The KCNQ2 sequencings done were selected from 131 nonconsanguineous pediatric epileptic patients (age
Franchette T Pascual et al.
Epilepsy & behavior case reports, 1, 35-38 (2013-01-01)
Benign familial neonatal seizures (BFNS) is an autosomal dominant disorder associated with heterozygous mutations of either the KCNQ2 or KCNQ3 gene. Most cases have mutations of the KCNQ2 gene. A handful of cases with KCNQ2 and CHRNA4 deletions have been
Nina Dirkx et al.
Frontiers in physiology, 11, 570588-570588 (2020-11-17)
Kv7.2 subunits encoded by the KCNQ2 gene constitute a critical molecular component of the M-current, a subthreshold voltage-gated potassium current controlling neuronal excitability by dampening repetitive action potential firing. Pathogenic loss-of-function variants in KCNQ2 have been linked to epilepsy since

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique