AV34374

Anti-CRIP2 antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-Cysteine-rich protein 2
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 22 kDa
• Espèces réactives: human, guinea pig
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès NCBI: NP_001303
• Numéro d'accès UniProt: P52943
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Informations sur le gène: human ... CRIP2(1397)

Description

Description générale

Cysteine-rich protein 2 (CRIP2) is a LIM-domain protein that can function as a transcriptional repressor of NF-κB-mediated expression of proangiogenic cytokines. Hence, CRIP2 can inhibit angiogenesis and cancer formation[1]. It can also facilitate apoptosis in esophageal squamous cell carcinoma[2].
Rabbit Anti-CRIP2 recognizes bovine, human, mouse, and rat CRIP2.

Immunogène

Synthetic peptide directed towards the N terminal region of human CRIP2

Application

Rabbit Anti-CRIP2 can be used for western blot applications at a concentration of 1 μg/ml.

Actions biochimiques/physiologiques

Human ESP1/CRP2 protein has two LIM domains, and each shares 35.1% and 77 or 79% identical residues with human cysteine-rich protein (CRP) and rat CRIP, respectively. Northern blot analysis of ESP1/CRP2 in various human tissues showed distinct tissue distributions compared with CRP and CRIP, suggesting that each might serve related but specific roles in tissue organization or function. Using a panel of human-rodent somatic cell hybrids, the ESP1/CRP2 locus was assigned to chromosome 14. Fluorescence in situ hybridization, using cDNA and a genome DNA fragment of the ESP1/CRP2 as probes, confirms this assignment and relegates regional localization to band 14q32.3.

Séquence

Synthetic peptide located within the following region: EKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCP

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable