Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

AV100932

Sigma-Aldrich

Anti-HOXA10 (AB2) antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-Homeobox A10

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μL
323.00 CHF

323.00 CHF


Date d'expédition estimée le30 mai 2025



Sélectionner une taille de conditionnement

Changer de vue
100 μL
323.00 CHF

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

323.00 CHF


Date d'expédition estimée le30 mai 2025


Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

41 kDa

Espèces réactives

dog, bovine, pig, rabbit, human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... HOXA10(3206)

Description générale

Homeobox A10 (HOXA10) is a homeodomain transcription factor involved in definitive hematopoiesis and implicated in the pathogenesis of acute myeloid leukemia (AML). HOXA10 facilitates myeloid progenitor expansion/proliferation while impeding myeloid differentiation. Sustained HoxA10expression during differentiation has been described in poor prognosis human acute myeloid leukemia (AML).
Rabbit polyclonal anti-HOXA10 antibody reacts with rabbit, pig, canine, mouse, bovine, human, and rat homeobox A10 transcription factors.

Immunogène

Synthetic peptide directed towards the N terminal region of human HOXA10

Application

Rabbit polyclonal anti-HOXA10 antibody is used to tag homeobox A10 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of homeobox A10 in hematopoiesis involving the expansion of myeloid progenitor populations and the development of acute myeloid leukemia (AML). Anti-HOXA10 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.

Actions biochimiques/physiologiques

HOXA10 is an important regulator of embryogenesis and lineage determination of hematopoietic progenitor cells. In primates, HOXA10 maintains uterine homeosis to regulate receptivity and implantation by synchronizing the maternal and embryonic signaling on the endometrial cells.

Séquence

Synthetic peptide located within the following region: SLGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRL

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Fei Li et al.
Molecular medicine reports, 11(1), 509-514 (2014-10-18)
The present study aimed to investigate whether gonadotropin-releasing hormone analogues (GnRH-as), including GnRH agonists and antagonists, affect endometrial homeobox (Hox) a10 DNA methylation during the implantation window in mice. GnRH analogue mouse models were used and were treated with either
G B Godbole et al.
Reproduction (Cambridge, England), 134(3), 513-523 (2007-08-22)
Homeobox A10 (HOXA10), a member of abdominal B subclass of homeobox genes, is responsible for uterine homeosis during development. Intriguingly, in the adult murine uterus, HOXA10 has been demonstrated to play important roles in receptivity, embryo implantation, and decidualization. However
Tom Taghon et al.
Blood, 99(4), 1197-1204 (2002-02-07)
Homeobox genes are well known for their crucial role during embryogenesis but have also been found to be critically involved in normal and leukemic hematopoiesis. Because most previous studies focused on the role of aberrant HOX gene expression in leukemogenesis

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique