Synthetic peptide directed towards the N terminal region of human PCDHA4
Application
Anti-PCDHA4 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Biochem/physiol Actions
Protocadherin alpha 4 (PCDHA4) is an integral plasma membrane protein that is crucial for the formation and function of cell-to-cell connections in the brain.
Sequence
Synthetic peptide located within the following region: VDRPLQVFHVDVEVRDINDNPPVFPATQKNLSIAESRPLDSRFPLEGASD
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Evaluation of somatic alterations of Pcdh-alpha transcripts in the brain by cDNA analysis without PCR.
Teruyoshi Hirayama et al.
Genes to cells : devoted to molecular & cellular mechanisms, 11(1), 95-97 (2005-12-24)
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.