MSQC3

SILu^™MAB Stable-Isotope Labeled Universal Monoclonal Antibody Standard human

recombinant, expressed in CHO cells

• Synonyme(s) : Mass spectrometry standard, IgG, Mass spectrometry standard, Immunoglobulin-G, Stable isotope labelled IgG
• Code UNSPSC : 23201100
• Nomenclature NACRES : NA.12

Propriétés

• Produit recombinant: expressed in CHO cells
• Niveau de qualité: 200
• Pureté: ≥90% (SDS-PAGE)
• Conditionnement: vial of 100 μg (± 10% Lot-specific vial content given on certificate of analysis)
• Conditions d'expédition: wet ice
• Température de stockage: −20°C

Description

Description générale

SILu^™Mab is a recombinant, stable isotope-labeled, human monoclonal antibody which incorporates [¹³C₆, ¹⁵N₄]-Arginine and [¹³C₆, ¹⁵N₂]-Lysine. Expressed in CHO cells, SILuMab is designed to be used as a universal internal standard for bioanalysis of monoclonal antibodies. Because of overlap with common sequences in the Fc region with candidate antibodies, SILuMab provides universal utility and thus eliminates the need to produce candidate-specific internal standards. SILuMab is an IgG1 antibody with lambda light chain, but contains peptide sequences common to other IgG isotypes.

Application

SILu^™MAB Stable-Isotope Labeled Universal Monoclonal Antibody Standard human has been used in a comparative study of automated antibody de novo sequencing.

Caractéristiques et avantages

Universal Peptide SequenceLocation
DTLMISRHeavy Chain (IgG1, IgG2, IgG3, IgG4)
FNWYVDGVEVHNAKHeavy Chain (IgG1)
VVSVLTVLHQDWLNGKHeavy Chain (IgG1, IgG3, IgG4)
NQVSLTCLVKHeavy Chain (IgG1, IgG2, IgG3, IgG4)
GFYPSDIAVEWESNGQPENNYKHeavy Chain (IgG1, IgG4)
AGVETTTPSKLight Chain (lambda)
YAASSYLSLTPEQWKLight Chain (lambda)

SILuMab has been validated as an internal standard for quantitation of relevant biotherapeutics in a complex biological matrix by MRM-based LC-MS/MS.

• SILuMab yielded reproducible, linear curves from 0.1 μg/mL to 1000 μg/mL without enrichment or depletion.
• Good agreement was observed between multiple peptides derived from the same target.
• Label incorporation was determined to be >98% by mass spectrometry.
• Sequence coverage was confirmed by peptide mapping.

Forme physique

Supplied as a lyophilized powder containing phosphate buffered saline

Notes préparatoires

Produced utilizing enriched media containing stable isotope labeled amino acids are ¹³C6, ¹⁵N4-labeled arginine and ¹³C6, ¹⁵N2-labeled lysine

SILuMab design is optimized to be used as an internal standard for quantitation of monoclonal antibodies as well as Fc-fusion therapeutics. Because of overlap with the common sequences in the Fc region with candidate antibodies, SILuMab provides univer­sal utility, thus eliminating the need for production of candidate-specific internal standards.

Reconstitution

SILuMab recovery is maximized when 0.1% formic acid is used for reconstitution of the lyophilized product. Reconstitution with other solvents may reduce recovery. Do not freeze after reconstitution.
Procedure

• Briefly centrifuge the vial at ~10,000 x g to collect the product at the bottom of the vial.
• Add 500 μL of purified water containing 0.1% formic acid to the vial.
• Mix the contents by gently inverting the vial a minimum of 5 times.
• Allow the vial to stand at room temperature for a minimum of 15 minutes and repeat mixing by inversion.

Remarque sur l'analyse

SILuMab Heavy Chain
EVQLVESGGGLVQPGGSLRLSCVASGFTLNNYDMHWVRQGIGKGLEWVSKI
GTAGDRYYAGSVKGRFTISRENAKDSLYLQMNSLRVGDAAVYYCARGAGRW
APLGAFDIWGQGTMVTVSS|ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYF
PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN
HKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR
TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV
VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS
RDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL
YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG

SILuMab Light Chain
QSALTQPRSVSGSPGQSVTISCTGTSSDIGGYNFVSWYQQHPGKAPKLMIY
DATKRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGDYTPGV
VFGGGTKLTVL|GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTV
AWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQ
VTHEGSTVEKTVAPTECS

Target overlap areas are underlined

Qualitative
Intact heavy and light chains (FASTA file)

Quantitative
MRM settings provided (Skyline, xls)

Package size based on protein content determined by A₂₈₀ using an extinction coefficient (E^0.1%) of 1.4

Informations légales

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.

SILu is a trademark of Sigma-Aldrich Co. LLC

Informations sur la sécurité

• Code de la classe de stockage: 11 - Combustible Solids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable