Accéder au contenu
Merck
Toutes les photos(2)

Principaux documents

SAB1405227

Sigma-Aldrich

Monoclonal Anti-POLD4 antibody produced in mouse

clone 2C11, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

POLDS, p12

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41
Le tarif et la disponibilité ne sont pas disponibles actuellement.

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

2C11, monoclonal

Forme

buffered aqueous solution

Poids mol.

antigen ~29.85 kDa

Espèces réactives

human

Technique(s)

capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... POLD4(57804)

Description générale

Mammalian DNA polymerase (Pol) δ contains four subunits, p125, p50, p68, and p12. DNA polymerase δ 4, accessory subunit (POLD4) is the smallest subunit of DNA polymerase δ. POLD4 gene is located on human chromosome 11q13.2.

Immunogène

POLD4 (AAH01334, 1 a.a. ~ 34 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MGRKRLITDSYPVVKRREGPAGHSKGELAPELGL

Actions biochimiques/physiologiques

Mammalian DNA polymerase (Pol) δ plays a key role in DNA replication. DNA polymerase δ 4, accessory subunit (POLD4) is involved in cell cycle progression. It helps to maintain the genomic stability of human cells. p12 is essential for the optimal activity of human Pol δ. p12 helps to stabilize Pol holoenzyme. Interaction of p12 with PCNA also aids in stabilizing the Pol-proliferating cell nuclear antigen (PCNA) complex. Lower expression of the POLD4 gene might participate in the progression of lung cancer.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Qin Miao Huang et al.
Biochemical and biophysical research communications, 391(1), 542-546 (2009-11-26)
Mammalian DNA polymerase delta (pol delta) is essential for DNA replication, though the functions of this smallest subunit of POLD4 have been elusive. We investigated pol delta activities in vitro and found that it was less active in the absence
Qin Miao Huang et al.
Cancer research, 70(21), 8407-8416 (2010-09-24)
Genomic instability is an important factor in cancer susceptibility, but a mechanistic understanding of how it arises remains unclear. We examined hypothesized contributions of the replicative DNA polymerase δ (pol δ) subunit POLD4 to the generation of genomic instability in
Melanie Haas Kucherlapati
Oncotarget, 10(65), 6913-6933 (2019-12-21)
Genes of the pre-replication, pre-initiation and replisome complexes duplicate the genome from many sites once in a normal cell cycle. This study examines complex components in lung adenocarcinoma (LUAD) closely, correlating changes in the genome and transcriptome with proliferation and

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique