SAB1401190

Anti-IAPP antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : AMYLIN, DAP, IAP
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.43

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Espèces réactives: human
• Numéro d'accès NCBI: NM_000415
• Numéro d'accès UniProt: P10997
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... IAPP(3375)

Description

Description générale

Islet, or insulinoma, amyloid polypeptide is commonly found in pancreatic islets of patients suffering diabetes mellitus type II, or harboring an insulinoma. While the assosciation of amylin with the development of type II diabetes has been known for some time, a direct causative role for amylin has been harder to establish. Studies suggest that amylin, like the related beta-amyloid (Abeta) associated with Alzheimer′s disease, can induce apoptotic cell-death in particular cultured cells, an effect that may be relevant to the development of type II diabetes. (provided by RefSeq)

Immunogène

IAPP (NP_000406.1, 1 a.a. ~ 89 a.a) full-length human protein.

Sequence
MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL

Actions biochimiques/physiologiques

IAPP (islet amyloid polypeptide) is secreted by the pancreatic β-cells along with insulin. IAPP is known to be involved in the regulation of gastric emptying, satiety and inhibiting glucagon secretion. IAPP is associated with type 2 diabetes mellitus where IAPP is part of amyloid deposits and is associated with mass and functional loss of β-cells. Oligomers and fibrils formed by IAPP is known to be toxic to the pancreatic islet β-cells.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable