MSST0064

SILu^™Prot Insulin, human

recombinant, expressed in Pichia pastoris, SIL MS Protein Standard, ¹⁵N -labeled

• Synonyme(s) : in situ Proximity Ligation Assay reagent, Insulin
• Code UNSPSC : 23201100
• Nomenclature NACRES : NA.32

Propriétés

• Produit recombinant: expressed in Pichia pastoris
• Niveau de qualité: 200
• Pureté: ≥95% (HPLC)
• Forme: dry pellets
• Puissance: ≥97% (Heavy amino acids incorporation efficiency by MS)
• Adéquation: suitable for mass spectrometry (standard)
• Numéro d'accès UniProt: P01308 (25-54, B chain; 90-110, A chain)
• Conditions d'expédition: ambient
• Température de stockage: −20°C
• Informations sur le gène: human ... INS(3630)

Description

Description générale

SILu^™ Prot Insulin is a recombinant, stable ¹⁵N isotope-labeled human Insulin Expressed in P. pastoris, it is designed to be used as an internal standard for bioanalysis of Insulin in mass-spectrometry. SILu^™ Prot Insulin is a disulfate bonded hetero-dimer protein composed of two chains. Chain A of 21 amino acids and a thoretical amolecular mass of 2408.5; Chain B of 30 amino acids and a thoretical amolecular mass of 3468.7 (Note that Thr30 in chain B is not ¹⁵N labeled).

Actions biochimiques/physiologiques

Insulin regulates the cellular uptake, utilization, and storage of glucose, amino acids, and fatty acids and inhibits the breakdown of glycogen, protein, and fat.

Séquence

A chain: GIVEQCCTSICSLYQLENYCN
B chain: FVNQHLCGSHLVEALYLVCGERGFFYTPKT

Forme physique

Supplied as dried pellet from a solution containing 1% acetic acid.

Informations légales

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.

SILu is a trademark of Sigma-Aldrich Co. LLC

Informations sur la sécurité

• Code de la classe de stockage: 11 - Combustible Solids
• Classe de danger pour l'eau (WGK): nwg
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable