HPA015270

Anti-STK4 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-MST-1, Anti-Mammalian STE20-like protein kinase 1, Anti-STE20-like kinase MST1, Anti-Serine/threonine-protein kinase 4, Anti-Serine/threonine-protein kinase Krs-2
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA015270
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: rat, mouse, human
• Validation améliorée: RNAi knockdown; Learn more about Antibody Enhanced Validation
• Technique(s): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• Séquence immunogène: IEHDDTLPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEF
• Numéro d'accès UniProt: Q13043
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... STK4(6789)

Description

Description générale

STK4 (serine/threonine kinase 4) is a kinase protein, which is ubiquitous in nature. It is homologous to yeast Ste20 and Drosophila Hippo protein. It has a molecular weight of 63kDa, and is a resident of the cytoplasm. It is also called MST1 (mammalian sterile 20-like protein), and has its active site at its N-terminal. It also contains an autoinhibitory domain, and a coiled-coil SARAH domain at its C-terminal. This domain is responsible for protein hetero- and homodimerization.

Immunogène

Serine/threonine-protein kinase 4 recombinant protein epitope signature tag (PrEST)

Application

Anti-STK4 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Actions biochimiques/physiologiques

STK4 (serine/threonine kinase 4) functions as both apoptotic and anti-apoptotic protein. It acts as an apoptotic protein upon its cleavage by caspases, which produces an N-terminal fragment of 36kDa. This fragment moves to the nucleus, where it phosphorylates histone proteins, resulting in apoptosis initiation. It also interacts with JNK (Jun N-terminal kinase) and RASSF1A (Ras association domain family member 1) to induce apoptosis. It phosphorylates FOXO1 (forkhead box O1) and FOXO3, which are transcription factors of FOXO family, in stress-response pathway. Thus, it maintains the viability of cell. Inactivation of this gene in lymphocytes and neutrophils leads to abnormal mitochondrial membrane potential. This results in increased chances of apoptotic death. Thus, loss of this gene, in humans is a cause of primary immunodeficiency syndrome. It is essential for the homing and maintenance of naïve T-cells, and deficiency in this gene leads to abnormal development and/or maintenance of regulatory T-cells.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST73444

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)