HPA012568

Anti-PVR antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-CD155 antigen, Anti-Necl-5, Anti-Nectin-like protein 5, Anti-Poliovirus receptor precursor
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA012568
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Validation améliorée: recombinant expression; orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• Technique(s): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:50-1:200
• Séquence immunogène: DVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFP
• Numéro d'accès UniProt: P15151
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... PVR(5817)

Description

Immunogène

Poliovirus receptor precursor recombinant protein epitope signature tag (PrEST)

Application

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Actions biochimiques/physiologiques

PVR (Poliovirus receptor) is a type I transmembrane glycoprotein belonging to the immunoglobulin (Ig) superfamily. It consists of three Ig-like domains (V-C2-C2). Its expression has been reported on the surface of acute B lymphoid leukemia (B-ALL) cells. It is mainly involved in the cell motility and cell-substrate adhesion mechanism. The active involvement of PVR in the cancer cell adhesion and migration can prove to be an effective therapeutic solution.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST71644

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)