Accéder au contenu
Merck
Toutes les photos(2)

Key Documents

AV46385

Sigma-Aldrich

Anti-ST3GAL5 antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-SIAT9, Anti-SIATGM3S, Anti-ST3 β-galactoside α-2,3-sialyltransferase 5, Anti-ST3GalV

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

48 kDa

Espèces réactives

human, rabbit, horse, rat, pig, mouse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

NP_003887

Numéro d'accès UniProt

Q6NZX4

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... ST3GAL5(8869)

Immunogène

Synthetic peptide directed towards the N terminal region of human ST3GAL5

Application

Anti-ST3GAL5 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml. It is also useful for immunohistochemistry at a concentration of 4-8μg/ml.

Actions biochimiques/physiologiques

ST3GAL5 (ST3 beta-galactoside alpha-2,3-sialyltransferase 5) gene also known as SIAT9, SIATGM3S, ST3GalV or GM3 synthase encodes for a Golgi type II membrane protein belongs to the glycosyltransferase family 29. ST3GAL5 plays a crucial role in the formation of GM3 using lactosylceramide as the substrate. Loss of function mutation in the ST3GAL5, encoding GM3 synthase results in incapability to synthesize alpha and beta series of gangliosides that may cause infantile epilepsy syndrome.

Séquence

Synthetic peptide located within the following region: DSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGS

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Michael A Simpson et al.
Nature genetics, 36(11), 1225-1229 (2004-10-27)
We identified an autosomal recessive infantile-onset symptomatic epilepsy syndrome associated with developmental stagnation and blindness. Assuming a founder effect in a large Old Order Amish pedigree, we carried out a genome-wide screen for linkage and identified a single region of
M L Allende et al.
Glycobiology, 10(10), 1025-1032 (2000-10-13)
Ganglioside GM2 synthase and other enzymes required for complex ganglioside synthesis were localized recently to the trans Golgi network (TGN). However, there are conflicting reports as to the location of GM3 synthase; originally this enzyme was detected in the early

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique