Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

374090

Sigma-Aldrich

Anti-Heme Oxygenase-1 (1-30) Rabbit pAb

liquid, Calbiochem®

Synonyme(s) :

Anti-HO-1, Anti-Hsp32

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Forme d'anticorps

purified antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

liquid

Contient

≤0.1% sodium azide as preservative

Espèces réactives

human, hamster, monkey, mouse, rat, canine

Fabricant/nom de marque

Calbiochem®

Conditions de stockage

OK to freeze
avoid repeated freeze/thaw cycles

Isotype

IgG

Conditions d'expédition

ambient

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... HMOX1(3162)

Description générale

Anti-Heme Oxygenase-1 (1-30), rabbit polyclonal, recognizes the ~32 kDa HO-1 protein. Does not cross-react with HO-2. It is validated for use in Western blotting and immunoprecipitation.
Protein A purified rabbit polyclonal antibody. Recognizes the ~32 kDa HO-1 protein.
Recognizes the ~32 kDa HO-1 protein. Does not cross-react with HO-2.

Immunogène

Human
a synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to amino acids 1-30 of human HO-1 prepared as a four-branched multiple antigen peptide

Application

Immunoblotting (1:1000, chemiluminescence)

Immunoprecipitation (1:100)

Avertissement

Toxicity: Standard Handling (A)

Forme physique

In PBS, 50% glycerol, pH 7.2.

Reconstitution

Following initial thaw, aliquot and freeze (-20°C).

Autres remarques

Does not cross-react with HO-2. Variables associated with assay conditions will dictate the proper working dilution.
Maines, M.D. 1988 FASEB J.2, 2557.
Kutty, R.K., et al. 1994. J. Cell Physiol.159, 371.
Yoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.
Trakshel, G.M., et al. 1986 J. Biol. Chem.261, 11131.

Informations légales

CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Da Hye Kwon et al.
International journal of molecular medicine, 41(1), 264-274 (2017-11-09)
Schisandrin A is a bioactive lignan occurring in the fruits of plants of the Schisandra genus that have traditionally been used in Korea for treating various inflammatory diseases. Although the anti-inflammatory and antioxidant effects of lignan analogues similar to schisandrin A have
Jin-Woo Jeong et al.
Foods (Basel, Switzerland), 8(8) (2019-07-31)
Sea tangle (Laminaria japonica Aresch), a brown alga, has been used for many years as a functional food ingredient in the Asia-Pacific region. In the present study, we investigated the effects of fermented sea tangle extract (FST) on receptor activator
Dong-Sung Lee et al.
Molecular medicine reports, 15(1), 451-459 (2016-12-14)
Liver diseases are considered to be primary contributors to morbidity and mortality rates in humans. Oxidative stress is critical in liver injury, and oxidant‑induced liver injury may be caused by toxins, including tert‑butyl hydroperoxide (t‑BHP). The present study investigated the
Seon Yeong Ji et al.
Biomolecules & therapeutics, 29(6), 685-696 (2021-04-07)
In this study, we investigated the inhibitory effect of 5-aminolevulinic acid (ALA), a heme precursor, on inflammatory and oxidative stress activated by lipopolysaccharide (LPS) in RAW 264.7 macrophages by estimating nitric oxide (NO), prostaglandin E2 (PGE2), cytokines, and reactive oxygen
Yun-Ta Liu et al.
Nutrients, 12(2) (2020-02-23)
14-Deoxy-11,12-didehydroandrographolide (deAND), a diterpenoid in Andrographis paniculata (Burm. f.) Nees, acts as a bioactive phytonutrient that can treat many diseases. To investigate the protective effects of deAND on reducing fatty liver disease, male mice were fed a high-fat and high-cholesterol

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique