Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Key Documents

WH0005741M5

Sigma-Aldrich

Monoclonal Anti-PTH antibody produced in mouse

clone 4A2, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-parathyroid hormone

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Numéro MDL:
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

4A2, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

immunoprecipitation (IP): suitable
indirect ELISA: suitable

Isotype

IgG2aκ

Numéro d'accès GenBank

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... PTH(5741)

Description générale

Parathyroid hormone (PTH) is a polypeptide hormone, synthesized via parathyroid gland. The 84 amino acid PTH protein is processed by Kupffer cells of the liver to give an N-terminal fragment (PTH 1-37) and a C-terminal fragment (PTH 38-84). The N-terminal fragment is crucial for the biological functions. The gene encoding PTH is localized on human chromosome 11p15.

Immunogène

PTH (NP_000306, 32 a.a. ~ 115 a.a) recombinant protein.

Sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ

Actions biochimiques/physiologiques

Parathyroid hormone (PTH) is a parathyroid-secreted polypeptide hormone that increases the level of calcium in blood by enhancing calcium mobilization from bone. It also increases the calcium: phosphate ratio in the kidney and promotes the absorption of calcium by the intestines. PTH acts as an anabolic agent that improves osteoblastic bone development.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Renal control of calcium, phosphate, and magnesium homeostasis.
Blane J
Clinical journal of the American Society of Nephrology : CJASN (2015)
Alendronate inhibits PTH (1-34)-induced bone morphogenetic protein expression in MC3T3-E1 preosteoblastic cells.
Issack PS
HSS Journal : The Musculoskeletal Journal of Hospital for Special Surgery (2007)
Chromosome mapping of genes on the short arm of human chromosome 11: parathyroid hormone gene is at 11p15 together with the genes for insulin, c-Harvey-ras 1, and beta-hemoglobin.
Cytogenetics and Cell Genetics (1985)
Parathyroid hormone induces adipocyte lipolysis via PKA-mediated phosphorylation of hormone-sensitive lipase.
Larsson S
Cellular Signalling (2016)
Sirtuin 1 is a negative regulator of parathyroid hormone stimulation of matrix metalloproteinase 13 expression in osteoblastic cells: role of sirtuin 1 in the action of PTH on osteoblasts.
Fei Y
The Journal of Biological Chemistry (2015)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique