Accéder au contenu
MilliporeSigma
Toutes les photos(4)

Documents

SAB2104467

Sigma-Aldrich

Anti-ETV1 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-DKFZp781L0674, Anti-ER81, Anti-MGC104699, Anti-MGC120533, Anti-MGC120534

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(4)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

55 kDa

Espèces réactives

dog, horse, mouse, guinea pig, human, rat, bovine

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

NM_004956

Numéro d'accès UniProt

P50549

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... ETV1(2115)

Description générale

Ets variant gene 1 (ETV1) is a novel androgen-regulated gene mapped to human chromosome 7p21.2. ETV1 protein belongs to the E-twenty-six (ETS) transcription factor family and it contains the ETS domain and acidic transactivation domain. ETV1 binds to DNA sequences containing the consensus pentanucleotide 5′-CGGA[AT]-3′.

Immunogène

Synthetic peptide directed towards the middle region of human ETV1

Application

Anti-ETV1 antibody produced in rabbit has been used in western blot(1:500)

Actions biochimiques/physiologiques

E-twenty-six (ETS) proteins participate in cell proliferation and cancer cell invasion. Ets variant gene 1 (ETV1) acts as a neuregulin-1 (NRG1) responsive factor and is important for establishing rapid conduction physiology in the heart. Overexpression of the gene has been observed in various types of cancers including prostate cancer and gastrointestinal stromal tumors

Séquence

Synthetic peptide located within the following region: PDNQRPLLKTDMERHINEEDTVPLSHFDESMAYMPEGGCCNPHPYNEGYV

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Ping Chi et al.
Nature, 467(7317), 849-853 (2010-10-12)
Gastrointestinal stromal tumour (GIST) is the most common human sarcoma and is primarily defined by activating mutations in the KIT or PDGFRA receptor tyrosine kinases. KIT is highly expressed in interstitial cells of Cajal (ICCs)-the presumed cell of origin for
Mark A Rubin et al.
Laboratory investigation; a journal of technical methods and pathology, 86(11), 1099-1102 (2006-09-20)
Recurrent chromosomal rearrangements have not been well characterized in common carcinomas. We describe the use of a novel bioinformatics approach to discover candidate oncogenic chromosomal aberrations on the basis of outlier gene expression called COPA (cancer outlier profile analysis). We
ETV1 is a novel androgen receptor-regulated gene that mediates prostate cancer cell invasion.
Cai, et al.
Molecular Endocrinology, 21, 1835-1846 (2013)
Xiao Song et al.
Cancer research, 79(20), 5288-5301 (2019-08-30)
Misregulated alternative RNA splicing (AS) contributes to the tumorigenesis and progression of human cancers, including glioblastoma (GBM). Here, we showed that a major splicing factor, serine and arginine rich splicing factor 3 (SRSF3), was frequently upregulated in clinical glioma specimens
La Ta et al.
Molecular medicine reports, 14(2), 1371-1378 (2016-06-10)
Constitutive photomorphogenic 1 (COP1) belongs to the COP‑de-etiolated (DET)‑fusca (FUS) protein family and has been demonstrated to suppress prostate adenocarcinomas and other types of tumor, such as liver and gastric cancer. The present study investigated the expression of COP1 and its
Afficher tous les articles scientifiques apparentés

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique