Accéder au contenu
MilliporeSigma
Toutes les photos(3)

Principaux documents

SAB1402559

Sigma-Aldrich

Monoclonal Anti-PVRL3 antibody produced in mouse

clone 1D1, purified immunoglobulin, buffered aqueous solution

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μG
715,00 $

715,00 $


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.


Sélectionner une taille de conditionnement

Changer de vue
100 μG
715,00 $

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

715,00 $


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.

Source biologique

mouse

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

1D1, monoclonal

Forme

buffered aqueous solution

Poids mol.

antigen ~37.99 kDa

Espèces réactives

human

Technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès NCBI

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... PVRL3(25945)

Description générale

Poliovirus receptor-related 3 (PVRL3), popularly known as nectin cell adhesion molecule 3 (NECTIN3), is expressed in various cells. It is part of the nectin family of proteins, which are cell adhesion molecules that modulate adherens junction formation. PVRL3 is a membrane protein with three extracellular immunoglobulin domains. The gene encoding it is localized on human chromosome 3q13.13.

Immunogène

PVRL3 (NP_056295, 59 a.a. ~ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PIIVEPHVTAVWGKNVSLKCLIEVNETITQISWEKIHGKSSQTVAVHHPQYGFSVQGEYQGRVLFKNYSLNDATITLHNIGFSDSGKYICKAVTFPLGNAQSSTTVTV

Application

Monoclonal Anti-PVRL3 antibody produced in mouse has been used for immunohistochemistry.

Actions biochimiques/physiologiques

Poliovirus receptor-related 3 (PVRL3) or nectin cell adhesion molecule 3 (NECTIN3) forms heterotypic adhesions with PVR, PVRL1 and PVRL2. The protein is involved in lymphocyte and monocyte extravasation. It also associates with afadin. PVRL3 has a role in the development of mammalian lens and ciliary body.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Nectin expression in pancreatic adenocarcinoma: nectin-3 is associated with a poor prognosis.
Izumi H
Surgery Today (2015)
Nectin-3 (CD113) interacts with Nectin-2 (CD112) to promote lymphocyte transendothelial migration.
Devilard E
PLoS ONE (2013)
Nectin4/PRR4, a new afadin-associated member of the nectin family that trans-interacts with nectin1/PRR1 through V domain interaction.
Reymond N
The Journal of Biological Chemistry (2001)
The cell adhesion gene PVRL3 is associated with congenital ocular defects.
Lachke SA
Human Genetics (2012)
Identification of an epithelial cell receptor responsible for Clostridium difficile TcdB-induced cytotoxicity
Michelle E. LaFrance
Proceedings of the National Academy of Sciences of the USA (2015)

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique