Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Principaux documents

MSST0058

Sigma-Aldrich

SILuLite IL8, Interleukin-8 human

recombinant, expressed in HEK 293 cells, MS Protein Standard

Synonyme(s) :

C-X-C motif chemokine 8, Chemokine (C-X-C motif), Emoctakin, Granulocyte chemotactic protein 1 (GCP-1), IL-8, Monocyte-derived neutrophil, Monocyte-derived neutrophil-activating peptide (MONAP), Neutrophil-activating protein 1 (NAP-1), Protein 3-10C, T-cell chemotactic factor, chemotactic factor (MDNCF), ligand 8

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
23201100
Nomenclature NACRES :
NA.32

Produit recombinant

expressed in HEK 293 cells

Niveau de qualité

Essai

≥95% (SDS-PAGE)

Forme

lyophilized powder

Adéquation

suitable for mass spectrometry (internal calibrator)

Numéro d'accès UniProt

Conditions d'expédition

ambient

Température de stockage

−20°C

Informations sur le gène

human ... CXCL8(3576)

Description générale

SILuLite IL8 is a recombinant human protein expressed in human 293 cells. It is a mixture of the 3 main CXCL8 isoforms with the molecular weights, amino acid number and relative abundance as described in Table 1 of the product datasheet. SILuLite IL8 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Actions biochimiques/physiologiques

Interleukin-8 (IL-8) is a member of the CXC chemokine subfamily and is produced by blood cells and many types of tissues. The measurement of IL-8 in voided urinary samples may have utility for urine-based detection of bladder cancer. Urinary IL-8 was a strong biomarker of stress under intensive and prolonged demands, both acutely and over time. IL-8 and cathepsin B levels were significantly elevated in melanoma patients, and more importantly, the combination of IL-8 and cathepsin B were also studied as a prognosis marker for melanoma mortality.

Séquence

EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Forme physique

Supplied as a lyophilized powder containing phosphate buffered saline.

Informations légales

SILu is a trademark of Sigma-Aldrich Co. LLC

Code de la classe de stockage

11 - Combustible Solids

Classe de danger pour l'eau (WGK)

WGK 2

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique