Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Documents

MSST0040

Sigma-Aldrich

SILu™Lite IFNG Interferon Gamma human

recombinant, expressed in HEK 293 cells, MS Protein Standard

Synonyme(s) :

IFNγ, IFN-gamma, Immune interferon, Immuneinterferon

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
23201100
Nomenclature NACRES :
NA.12

Source biologique

human

Niveau de qualité

200

Produit recombinant

expressed in HEK 293 cells

Pureté

≥98% (SDS-PAGE)

Forme

lyophilized powder

Puissance

≥98% Heavy amino acids incorporation efficiency by MS

Poids mol.

calculated mol wt 17 kDa

Technique(s)

mass spectrometry (MS): suitable

Adéquation

suitable for mass spectrometry (internal calibrator)

Numéro d'accès UniProt

P01579

Température de stockage

−20°C

Informations sur le gène

human ... IFNG(3458)

Description générale

Interferon gamma (IFNγ) is a dimerized soluble cytokine that is the only member of the type II class of interferons. IFNγ is secreted by T helper cells (specifically, Th1 cells), cytotoxic T cells (TC cells) and Natural killer (NK) cells. When combined with other inflammatory cytokines, evaluating the levels of IFNγ can be used as a diagnostic tool in patients with breast cancer or benign prostatic hyperplasia. A recent study evaluated the effect of a cancer vaccine given to patients with colorectal cancer, on the levels of plasma pro-inflammatory cytokines (including IFN-γ). The study concluded that patients achieving stable disease showed increasing levels of plasma inflammatory cytokines.

Immunogène

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG

Actions biochimiques/physiologiques

SILu™Lite IFNG is a recombinant human protein expressed in human 293 cells. It is a homodimer consisting of 138 amino acids Expressed in human 293 cells, with a calculated molecular mass of 17 kDa. SILu Lite IFNG is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Forme physique

Lyophilized from a solution of phosphate buffered saline.

Informations légales

SILu is a trademark of Sigma-Aldrich Co. LLC

Code de la classe de stockage

11 - Combustible Solids

Classe de danger pour l'eau (WGK)

WGK 2

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique