Accéder au contenu
MilliporeSigma
Toutes les photos(5)

Principaux documents

MSST0001

Sigma-Aldrich

SILuProt APOA1, Apolipoprotein A-1 human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, 13C- and 15N-labeled

Synonyme(s) :

SILuProt Apolipoprotein A-1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

10 μG
1 160,00 $

1 160,00 $


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.

Devis pour commande en gros

Sélectionner une taille de conditionnement

Changer de vue
10 μG
1 160,00 $

About This Item

Code UNSPSC :
23201100
Nomenclature NACRES :
NA.12

1 160,00 $


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.

Devis pour commande en gros

Source biologique

human

Niveau de qualité

Produit recombinant

expressed in HEK 293 cells

Étiquette/Marqueur

His tagged
V5 tagged

Essai

≥98% (SDS-PAGE)

Forme

lyophilized powder

Conditionnement

vial of ≥10 μg (Lot-specific vial content given on certificate of analysis)

Technique(s)

mass spectrometry (MS): suitable

Numéro d'accès UniProt

Température de stockage

−20°C

Informations sur le gène

human ... APOA1(335)

Description générale

ApoA-1 (apolipoprotein A-1) is a 29.0kDa protein produced in the liver and intestine, and secreted as the predominant constituent of nascent high-density lipoprotein (HDL) particle.[1][2] BP- ApoA-1 (apolipoprotein A-1), which is found exclusively in HDL (high-density lipoprotein), has a unique ability to capture and solubilize free cholesterol.[3] This apoA-1 ability enables HDL to remove excess peripheral cholesterol and return it to the liver for recycling and excretion.[4] The therapeutic potential of apoA-1 has been recently assessed in patients with acute coronary syndromes, using a recombinant form of a naturally occurring variant of apoA-1 (called apoA-1 Milano). The availability of recombinant normal apoA-1 should facilitate further investigation into the potential usefulness of apoA-1 in preventing atherosclerotic vascular diseases.[5] Changes in the level of serum apoA-1 may serve as a prognostic marker for non-metastatic nasopharyngeal carcinoma.[6] Low levels of apoA-1 in the plasma are linked to hyperhomocysteinemia.[7]

Forme physique

Supplied as a lyophilized powder containing phosphate buffered saline.

Notes préparatoires

Briefly centrifuge the vial before opening. It is recommended to reconstitute the protein in sterile ultrapure water to a final concentration of 100μg/ml.

Stockage et stabilité

Store the lyophilized product at –20 oC. The product is stable for at least 2 years as supplied. After reconstitution, it is recommended to store the protein in working aliquots at –20 oC.

Remarque sur l'analyse

General description

SILuProt ApoA−Ι is a recombinant, stable isotope-labeled human Apo A1 which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of ApoA1 in mass-spectrometry. SILu Prot Apo A-Ι is a monomer of 280 amino acids (including C-terminal polyhistidine and V5 tags), with an apparent molecular weight of 32.3 kDa.

Sequence

RHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLK
LLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKV
QPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEM
RDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEK
AKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQSDPSRGPFEGK
PIPNPLLGLDSTRTGHHHHHHHHGGQ


The N-terminal signal peptide and C-terminal linker peptide, V5 and polyhistidine tags are italicized. Suggested transitions for three peptides (bolded) are used for selected reaction monitoring analysis (SRM).

Label Incorporation
≥ 98% as determined by mass spectrometry

Other Characterization
  • Sequence confirmed by intact mass analysis
  • Identity verified by peptide mapping
  • Purity >98% by SDS-PAGE
  • Vial content was determined by the Bradford method using BSA as a calibrator. The correction factor of Bradford-to-AAA is 88.33%

Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides)

Informations légales

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), [email protected].
SILu is a trademark of Sigma-Aldrich Co. LLC

Code de la classe de stockage

11 - Combustible Solids

Classe de danger pour l'eau (WGK)

WGK 2

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

ABCA1 and ABCG1 synergize to mediate cholesterol export to apoA-I.
Gelissen I C, et al.
Arteriosclerosis, Thrombosis, and Vascular Biology, 26(3), 534-540 (2006)
Serum apolipoprotein AI is a novel prognostic indicator for non-metastatic nasopharyngeal carcinoma.
Luo X, et al.
Oncotarget, 6(41), 44037-44037 (2015)
Scavenger receptor class B type I as a mediator of cellular cholesterol efflux to lipoproteins and phospholipid acceptors.
Jian B, et al.
The Journal of Biological Chemistry, 273(10), 5599-5606 (1998)
Centripetal cholesterol flux to the liver is dictated by events in the peripheral organs and not by the plasma high density lipoprotein or apolipoprotein AI concentration.
Jolley C D, et al.
Journal of Lipid Research, 39(11), 2143-2149 (1998)
Hyperhomocysteinemia is associated with decreased apolipoprotein AI levels in normal healthy people.
Wang Y. et al.
BMC Cardiovascular Disorders, 16(1), 10-10 (2016)

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique