Accéder au contenu
MilliporeSigma
Toutes les photos(2)

Documents

HPA051171

Sigma-Aldrich

Anti-FKBP10 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-FK506 binding protein 10, 65 kDa, Anti-FKBP6, Anti-FLJ20683, Anti-FLJ22041, Anti-FLJ23833, Anti-hFKBP65

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
Nomenclature NACRES :
NA.43

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50

Séquence immunogène

CSLLDGTQLFTSHDYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGESGARGVPGSAVLLFEVELVSRED

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... FKBP10(60681)

Description générale

FK506 binding protein 10 (FKBP10) is expressed in the endoplasmic reticulum. It is a peptidyl-prolyl cis-trans isomerase, with a molecular weight of 65kDa. The gene encoding this protein is localized on human chromosome 17q21.2.

Immunogène

FK506 binding protein 10, 65 kDa recombinant protein epitope signature tag (PrEST)

Application

Anti-FKBP10 antibody produced in rabbit has been used in immunohistochemistry.

Actions biochimiques/physiologiques

FK506 binding protein 10 (FKBP10) is a chaperone protein. It is thought to be a chaperone of type I collagen. Mutations in the FKBP10 gene have been linked to Bruck syndrome, which is characterized by bone fragility and congenital joint contractures.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST85546

Forme physique

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Bruck syndrome - a rare syndrome of bone fragility and joint contracture and novel homozygous FKBP10 mutation.
Moravej H, et. Al
Endokrynologia Polska, 66(2), 170-174 (2015)
Integration of zebrafish fin regeneration genes with expression data of human tumors in silico uncovers potential novel melanoma markers
Martin Hagedorn
Oncotarget, 7(44), 71567?71579-71567?71579 (2016)
Osama H Essawi et al.
European journal of medical genetics, 63(9), 103980-103980 (2020-06-13)
To date 45 autosomal recessive disease-causing variants are reported in the FKBP10 gene. Those variant were found to be associated with Osteogenesis Imperfecta (OI) for which the hallmark phenotype is bone fractuers or Bruck Syndrome (BS) where bone fractures are
Kuskokwim syndrome, a recessive congenital contracture disorder, extends the phenotype of FKBP10 mutations
Aileen M. Barnes
Human Mutation, 34(9), 1279?1288-1279?1288 (2013)
Michael C J Quinn et al.
International journal of oncology, 42(3), 912-920 (2013-01-29)
The frequent loss of chromosome 17 in epithelial ovarian carcinomas (EOC), particularly high-grade serous carcinomas (HGSC), has been attributed to the disruption of TP53 (at 17p13.1) and other chromosome 17 genes suspected to play a role in tumour suppressor pathways.

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique