Accéder au contenu
MilliporeSigma
Toutes les photos(4)

Principaux documents

HPA005700

Sigma-Aldrich

Anti-MAPK3/ERK1 Antibody

Prestige Antibodies® Powered by Atlas Antibodies, rabbit polyclonal

Synonyme(s) :

Anti-ERK-1 antibody produced in rabbit, Anti-ERT2 antibody produced in rabbit, Anti-Extracellular signal-regulated kinase 1 antibody produced in rabbit, Anti-Insulin-stimulated MAP2 kinase antibody produced in rabbit, Anti-MAP kinase 1 antibody produced in rabbit, Anti-MAPK 1 antibody produced in rabbit, Anti-Microtubule-associated protein 2 kinase antibody produced in rabbit, Anti-Mitogen-activated protein kinase 3 antibody produced in rabbit, Anti-p44-ERK1 antibody produced in rabbit, Anti-p44-MAPK antibody produced in rabbit

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μL
733,00 $

733,00 $


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.


Sélectionner une taille de conditionnement

Changer de vue
100 μL
733,00 $

About This Item

Numéro MDL:
Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
Nomenclature NACRES :
NA.41

733,00 $


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.

Nom du produit

Anti-MAPK3 antibody produced in rabbit, Ab2, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

rat, human, mouse

Technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50

Séquence immunogène

EVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... MAPK3(5595)

Vous recherchez des produits similaires ? Visite Guide de comparaison des produits

Description générale

Mitogen-activated protein kinase 3 (MAPK3) is a member of the MAP kinase family and is involved in various cell signalling pathways.

Immunogène

Mitogen-activated protein kinase 3 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Actions biochimiques/physiologiques

Mitogen-activated protein kinase 3 (MAPK3) is involved actively in signaling modules through which cells transduce extracellular signals into intracellular responses. The different pathways have been associated with the regulation of cellular proliferation, differentiation, angiogenesis, embryo development and tumor invasion. In the Ras/extracellular signal-regulated kinase (ERK) pathway, the p90 ribosomal S6 kinases (RSKs) lie at the terminus of the ERK pathway. RSK activation by ERK requires its interaction through a docking site located near the C terminus of RSK. They form a complex which is further involved in activating and recruiting other proteins downstream for the pathway. In another pathway dealing with cell proliferation and differentiation, Raf phosphorylates and activates MEK1/2, which phosphorylates MAPK3 on Thr183 and Tyr185 in the activation loop resulting in full activation of MAPK3. Phosphorylation and de-phosphorylation of MAPK3 provides a rapid and reversible regulatory system to control its activity.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST86538

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Zhimin Lu et al.
Molecular cell, 9(5), 945-956 (2002-06-07)
ERK1/2 MAP kinases are important regulators in cellular signaling, whose activity is normally reversibly regulated by threonine-tyrosine phosphorylation. In contrast, we have found that stress-induced ERK1/2 activity is downregulated by ubiquitin/proteasome-mediated degradation of ERK1/2. The PHD domain of MEKK1, a
Philippe P Roux et al.
Molecular and cellular biology, 23(14), 4796-4804 (2003-07-02)
Stimulation of the Ras/extracellular signal-regulated kinase (ERK) pathway can modulate cell growth, proliferation, survival, and motility. The p90 ribosomal S6 kinases (RSKs) comprise a family of serine/threonine kinases that lie at the terminus of the ERK pathway. Efficient RSK activation

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique