AV54329
Anti-IL4 antibody produced in rabbit
affinity isolated antibody
Synonyme(s) :
Anti-BSF1, Anti-IL-4, Anti-Interleukin 4, Anti-MGC79402
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41
Produits recommandés
Source biologique
rabbit
Niveau de qualité
Conjugué
unconjugated
Forme d'anticorps
affinity isolated antibody
Type de produit anticorps
primary antibodies
Clone
polyclonal
Forme
buffered aqueous solution
Poids mol.
15 kDa
Espèces réactives
human
Concentration
0.5 mg - 1 mg/mL
Technique(s)
western blot: suitable
Numéro d'accès NCBI
Numéro d'accès UniProt
Conditions d'expédition
wet ice
Température de stockage
−20°C
Informations sur le gène
human ... IL4(3565)
Catégories apparentées
Immunogène
Synthetic peptide directed towards the middle region of human IL4
Application
Anti-IL4 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Actions biochimiques/physiologiques
Interleukin-4 (IL-4) is a T cell derived chemokine that stimulates the Th2 mediated immune response and proliferation of B cells. The effects of IL-4 are mediated by two types of receptors, type I receptor consisting of IL-4Rα and common γ chain and type II receptor composed of IL-4Rα and IL-13Rα1. The signalling stimulated by IL-4 leads to activation of JAK/STAT6 and IRS-mediated PI3K/Akt pathway. Through these pathways, IL-4 is responsible for endocytic activity of macrophages, chemotaxis of leukocytes in response to inflammation, angiogenesis and regulation of nitric oxide metabolism in macrophages. Anti-tumor effects of IL-4 have been reported in cancers of breast, liver and renal cells.
Séquence
Synthetic peptide located within the following region: TVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSC
Forme physique
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Classe de danger pour l'eau (WGK)
WGK 3
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Michal Kuczma et al.
Journal of immunotoxicology, 11(4), 319-327 (2013-12-20)
Immunotherapy is becoming an increasingly attractive therapeutic alternative for conventional cancer therapy. In recent years Foxp3(+) regulatory T-cells (T(R)) were identified as the major obstacle to effective cancer immunotherapy. The abundance of these cells in peripheral blood is increased in
C K Oh et al.
European respiratory review : an official journal of the European Respiratory Society, 19(115), 46-54 (2010-10-20)
Asthma is a complex, persistent, inflammatory disease characterised by airway hyperresponsiveness in association with airway inflammation. Studies suggest that regular use of high-dose inhaled corticosteroids and long-acting bronchodilators or omalizumab (a humanised monoclonal antibody that binds to immunoglobulin E and
Kerstin Göbel et al.
European journal of immunology, 44(8), 2295-2305 (2014-05-09)
Lymphocyte adhesion and subsequent trafficking across endothelial barriers are essential steps in various immune-mediated disorders of the CNS, including MS. The molecular mechanisms underlying these processes, however, are still unknown. Phospholipase D1 (PLD1), an enzyme that generates phosphatidic acid through
Julie Ann et al.
Vaccine, 32(43), 5730-5739 (2014-09-01)
Influenza viruses are major respiratory pathogens and the development of improved vaccines to prevent these infections is of high priority. Here, we evaluated split inactivated A(H3N2) vaccines (A/Uruguay/716/2007) combined or not with adjuvants (AS03, AS25 and Protollin) and administered by
Smanla Tundup et al.
Infection and immunity, 82(8), 3240-3251 (2014-05-29)
Antigen-presenting cell (APC) plasticity is critical for controlling inflammation in metabolic diseases and infections. The roles that pattern recognition receptors (PRRs) play in regulating APC phenotypes are just now being defined. We evaluated the expression of PRRs on APCs in
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique