Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Principaux documents

AV46950

Sigma-Aldrich

Anti-ST6GALNAC6 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-RP11-203J24.3, Anti-SIAT7F, Anti-ST6 -N-acetylgalactosaminide α-2,6-sialyltransferase 6, Anti-ST6GALNACVI

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μL
725,00 $

725,00 $


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.


Sélectionner une taille de conditionnement

Changer de vue
100 μL
725,00 $

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

725,00 $


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

38 kDa

Espèces réactives

rabbit, dog, guinea pig, horse, human, rat, mouse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

Immunogène

Synthetic peptide directed towards the C terminal region of human ST6GALNAC6

Application

Anti-ST6GALNAC6 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/mL.

Actions biochimiques/physiologiques

ST6GALNAC6 [ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6] gene encodes a single-pass type II membrane protein that belongs to glycosyltransferase 29 family and is primarily expressed in kidney, in proximal tubule epithelial cells and colon cell lines. It plays a crucial role in biosynthesis of DSGG (disialylgalactosylgloboside) from MSGG (monosialylgalactosylgloboside) in normal and malignant kidney. It is also involved in the synthesis of disialyl Lewis a (Lea).

Séquence

Synthetic peptide located within the following region: YHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHP

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Akiko Tsuchida et al.
The Journal of biological chemistry, 278(25), 22787-22794 (2003-04-02)
Biosynthesis of disialyl Lewis a (Lea) was analyzed using previously cloned ST6GalNAc V and ST6GalNAc VI, which were responsible for the synthesis of alpha-series gangliosides. Among lactotetraosylceramide (Lc4), neolactotetraosylceramide, and their sialyl forms, only sialyl Lc4 was sialylated with ST6GalNAc
Motohiro Senda et al.
The Biochemical journal, 402(3), 459-470 (2006-11-25)
Although disialyl glycosphingolipids such as GD3 and GD2 have been considered to be associated with malignant tumours, whether branched-type disialyl glycosphingolipids show such an association is not well understood. We investigated the sialyltransferases responsible for the biosynthesis of DSGG (disialylgalactosylgloboside)

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique