Accéder au contenu
MilliporeSigma
Toutes les photos(3)

Principaux documents

AV46802

Sigma-Aldrich

Anti-SILV antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-D12S53E, Anti-Gp100, Anti-ME20, Anti-PMEL17, Anti-SI, Anti-SIL, Anti-Silver homolog (mouse)

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(3)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

70 kDa

Espèces réactives

mouse, human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

NP_008859

Numéro d'accès UniProt

P40967

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SILV(6490)

Immunogène

Synthetic peptide directed towards the N terminal region of human SILV

Application

Anti-SILV antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/mL. It is also useful for immunohistochemistry at a concentration of 4-8μg/mL.

Actions biochimiques/physiologiques

SILV [Silver homolog (mouse)] gene encodes a melanocyte-specific type I transmembrane glycoprotein expressed primarily in melanocytes and at low levels in normal cell lines and tissues. It facilitates in the structural organization of premelanosomes within multivesicular bodies. The encoded protein is also involved in generating internal matrix fibers that define the transition from stage I to stage II melanosomes.

Séquence

Synthetic peptide located within the following region: HFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTY

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number
QC16880

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Rechercher un(e) COA

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

T Bailin et al.
The Journal of investigative dermatology, 106(1), 24-27 (1996-01-01)
We have determined the DNA sequence and genomic organization of D12S53E (Pmel 17), the human homologue of the mouse silver (si) locus. D12S53E encodes a melanosomal matrix protein whose expression is closely correlated with cellular melanin content and which is
J F Berson et al.
Molecular biology of the cell, 12(11), 3451-3464 (2001-11-06)
Melanosomes are tissue-specific organelles within which melanin is synthesized and stored. The melanocyte-specific glycoprotein Pmel17 is enriched in the lumen of premelanosomes, where it associates with characteristic striations of unknown composition upon which melanin is deposited. However, Pmel17 is synthesized

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique