AV32519
Anti-FOSB antibody produced in rabbit
IgG fraction of antiserum
Synonyme(s) :
Anti-FBJ murine osteosarcoma viral oncogene homolog B
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41
Produits recommandés
Source biologique
rabbit
Niveau de qualité
Conjugué
unconjugated
Forme d'anticorps
IgG fraction of antiserum
Type de produit anticorps
primary antibodies
Clone
polyclonal
Forme
buffered aqueous solution
Poids mol.
36 kDa
Espèces réactives
human, horse, bovine
Concentration
0.5 mg - 1 mg/mL
Technique(s)
immunohistochemistry: suitable
western blot: suitable
Numéro d'accès NCBI
Numéro d'accès UniProt
Conditions d'expédition
wet ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... FOSB(2354)
Description générale
FOSB is a leucine zipper protein that functions as a transcriptional regulator. Studies in mice have reported that FOSB is involved in cocaine-induced behavioral responses.
Rabbit Anti-FOSB antibody recognizes human, mouse, rat, bovine, and canine FOSB.
Rabbit Anti-FOSB antibody recognizes human, mouse, rat, bovine, and canine FOSB.
Immunogène
Synthetic peptide directed towards the C terminal region of human FOSB
Application
Rabbit Anti-FOSB antibody can be used for IHC (4-8μg/ml) and western blot (1.25μg/ml) applications.
Actions biochimiques/physiologiques
The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. They are leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation.
Séquence
Synthetic peptide located within the following region: DLPGSAPAKEDGFSWLLPPPPPPPLPFQTSQDAPPNLTASLFTHSEVQVL
Forme physique
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Classe de danger pour l'eau (WGK)
WGK 3
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
R F De Pauli et al.
Pharmacology, biochemistry, and behavior, 117, 70-78 (2013-12-21)
Chronic drug exposure and drug withdrawal induce expressive neuronal plasticity which could be considered as both functional and pathological responses. It is well established that neuronal plasticity in the limbic system plays a pivotal role in relapse as well as
N Hiroi et al.
Proceedings of the National Academy of Sciences of the United States of America, 94(19), 10397-10402 (1997-09-18)
Chronic exposure to cocaine leads to prominent, long-lasting changes in behavior that characterize a state of addiction. The striatum, including the nucleus accumbens and caudoputamen, is an important substrate for these actions. We previously have shown that long-lasting Fos-related proteins
Izabelle Dias Benfato et al.
Behavioural brain research, 417, 113630-113630 (2021-10-18)
Social isolation gained discussion momentum due to the COVID-19 pandemic. Whereas many studies address the effects of long-term social isolation in post-weaning and adolescence and for periods ranging from 4 to 12 weeks, little is known about the repercussions of
Josy Carolina C Pontes et al.
Epilepsy research, 126, 16-25 (2016-07-16)
The efficiency of most of the new antiepileptic drugs (AEDs) on clinical trials still falls short the success reported in pre-clinical studies, possibly because the validity of the animal models is insufficient to fully represent the human pathology. To improve
M C Gruda et al.
Oncogene, 12(10), 2177-2185 (1996-05-16)
FosB, one of the members of the Fos family, is rapidly induced in many cell types upon stimulation and has a stimulatory effect on the proliferation of cultured cells. To understand the tissue distribution of FosB, we have studied its
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique