Accéder au contenu
MilliporeSigma
Toutes les photos(2)

Key Documents

AV41699

Sigma-Aldrich

Anti-PKLR antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-PK1, Anti-PKL, Anti-Pyruvate kinase, liver and RBC, Anti-RPK

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

58 kDa

Espèces réactives

human, rat, pig, rabbit, bovine, dog, mouse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

NP_000289

Numéro d'accès UniProt

P30613-2

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... PKLR(5313)

Catégories apparentées

Description générale

Pyruvate kinase (PKLR) is a liver/erythrocyte-specific enzyme that exists as a tetramer. It comprises structural and functional domains namely N. A and C domains. The C domain is erythrocyte-specific and the A domain is active site residues. The PKLR gene is mapped to human chromosome 1q22.

Immunogène

Synthetic peptide directed towards the N terminal region of human PKLR

Application

Anti-PKLR antibody produced in rabbit has been used in western blotting.

Actions biochimiques/physiologiques

Pyruvate kinase (PKLR) is needed for energy generation in erythrocytes. Deficiency of PKLR in mice reduces the risk of blood-stage malarial parasite Plasmodium chabaudi induced infection.

Séquence

Synthetic peptide located within the following region: STSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEYHAESIANVRE

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Daiki Nakatsu et al.
Proceedings of the National Academy of Sciences of the United States of America, 112(10), E1067-E1076 (2015-02-26)
Increase in the concentration of plasma L-cysteine is closely associated with defective insulin secretion from pancreatic β-cells, which results in type 2 diabetes (T2D). In this study, we investigated the effects of prolonged L-cysteine treatment on glucose-stimulated insulin secretion (GSIS)
Rebekah van Bruggen et al.
PloS one, 10(12), e0144555-e0144555 (2015-12-15)
Pyruvate kinase (PKLR) is a critical erythrocyte enzyme that is required for glycolysis and production of ATP. We have shown that Pklr deficiency in mice reduces the severity (reduced parasitemia, increased survival) of blood stage malaria induced by infection with
Nicholas Wong et al.
International journal of cell biology, 2013, 242513-242513 (2013-03-12)
Aerobic glycolysis is the dominant metabolic pathway utilized by cancer cells, owing to its ability to divert glucose metabolites from ATP production towards the synthesis of cellular building blocks (nucleotides, amino acids, and lipids) to meet the demands of proliferation.
Erin J Stephenson et al.
Nature communications, 13(1), 6062-6062 (2022-10-14)
Almost all effective treatments for non-alcoholic fatty liver disease (NAFLD) involve reduction of adiposity, which suggests the metabolic axis between liver and adipose tissue is essential to NAFLD development. Since excessive dietary sugar intake may be an initiating factor for
Hua-Lin Zhou et al.
Nature, 565(7737), 96-100 (2018-11-30)
Endothelial nitric oxide synthase (eNOS) is protective against kidney injury, but the molecular mechanisms of this protection are poorly understood1,2. Nitric oxide-based cellular signalling is generally mediated by protein S-nitrosylation, the oxidative modification of Cys residues to form S-nitrosothiols (SNOs).

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique