AV39172

Anti-POGZ antibody produced in rabbit

IgG fraction of antiserum

• Synonyme(s) : Anti-Pogo transposable element with ZNF domain
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: IgG fraction of antiserum
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 155 kDa
• Espèces réactives: rat, mouse, dog, bovine, rabbit, guinea pig, horse, human
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): immunohistochemistry: suitable; western blot: suitable
• Numéro d'accès NCBI: NP_055915
• Numéro d'accès UniProt: Q7Z3K3
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... POGZ(23126)

Description

Description générale

POGZ is a zinc-finger protein known to interact with HP1α. Studies have reported that POGZ regulates the dissociation of Aurora B kinase from chromosomal arms during the M phase of the cell cycle.
Rabbit Anti-POGZ antibody recognizes human, mouse, rat, canine, rabbit, and bovine POGZ.

Immunogène

Synthetic peptide directed towards the N terminal region of human POGZ

Application

Rabbit Anti-POGZ antibody is suitable for western blot (5.0 μg/ml) and IHC (4-8 μg/ml) applications.

Actions biochimiques/physiologiques

POGZ appears to be a zinc finger protein containing a transposase domain at the C-terminus. This protein was found to interact with the transcription factor SP1 in a yeast two-hybrid systemThe protein encoded by this gene appears to be a zinc finger protein containing a transposase domain at the C-terminus. This protein was found to interact with the transcription factor SP1 in a yeast two-hybrid system. At least three alternatively spliced transcript variants encoding distinct isoforms have been observed.

Séquence

Synthetic peptide located within the following region: EELEPWQKISDVIEDSVVEDYNSVDKTTTVSVSQQPVSAPVPIAAHASVA

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable