Accéder au contenu
MilliporeSigma
Toutes les photos(3)

Key Documents

AV32797

Sigma-Aldrich

Anti-SCD antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-Stearoyl-CoA desaturase (δ-9-desaturase)

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

41 kDa

Espèces réactives

human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SCD(6319)

Description générale

Rabbit polyclonal anti-SCD antibody reacts with human and bovine stearoyl-CoA desaturases.
Stearoyl-CoA desaturase (SCD) is a rate-limiting enzyme that catalyses the conversion of saturated fatty acids to monounsaturated fatty acids (MUFA). SCD functions as a homeostatic check-point between glucose and fatty acid metabolism. It is a key enzyme target in the search for potential drugs to manage obesity.

Immunogène

Synthetic peptide directed towards the middle region of human SCD

Application

Rabbit Anti-SCD antibody can be used for western blot applications at a concentration of 1.0 μg/ml. It can also be used for IHC at 4-8 μg/ml, using paraffin-embedded tissues.
Rabbit polyclonal anti-SCD antibody is used to tag stearoyl-CoA desaturase for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of stearoyl-CoA desaturases in the homeostasis of fatty acid metabolism at the level of monounsaturation.

Actions biochimiques/physiologiques

Stearoyl-CoA desaturase ( fatty acid desaturase, SCD) is expressed at high levels in several human tissues and is required for the biosynthesis of oleate (18:1) and palmitoleate (16:1). These monounsaturated fatty acids are the major components of phospholipids, triglycerides, wax esters, and cholesterol esters.

Séquence

Synthetic peptide located within the following region: HPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWG

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Ana S H Costa et al.
PloS one, 13(4), e0193875-e0193875 (2018-04-04)
Despite the recent advances in transcriptomics, gene expression studies addressing cattle´s skeletal muscle adaptations in response to compensatory growth are warranted, particularly regarding lipid metabolism due to its impact in meat sensory and nutritional traits. In the present study, in

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique