Accéder au contenu
Merck
Toutes les photos(4)

Documents

WH0055145M1

Sigma-Aldrich

Monoclonal Anti-THAP1 antibody produced in mouse

clone 2C1-2F2, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-FLJ10477, Anti-MGC33014, Anti-THAP domain containing, apoptosis associated protein 1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(4)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

2C1-2F2, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2bκ

Numéro d'accès GenBank

BC021721

Numéro d'accès UniProt

Q9NVV9

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... THAP1(55145)

Description générale

THAP domain containing 1 (THAP1) is a transcription factor encoded by the gene mapped to human chromosome 18p11.21. The encoded protein contains an N-terminal conserved DNA-binding domain, designated THAP domain with a zinc-finger structure.

Immunogène

THAP1 (AAH21721, 1 a.a. ~ 213 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTPDCFKRECNNKLLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPLPPPVSQVDAAIGLLMPPLQTPVNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYFEIVEVPA

Actions biochimiques/physiologiques

THAP domain containing 1 (THAP1) plays a key role in endothelial cell proliferation and pro-apoptotic processes. Mutation in the gene is associated with primary dystonia type 6 (DYT6). The encoded protein links prostate-apoptosis-response-4 (Par-4) to promyelocytic leukemia (PML) nuclear bodies, which facilitates both serum withdrawal and tumor necrosis factor-α (TNF-α)-induced apoptosis.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

nwg

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Intrafamilial variability of the primary dystonia DYT6 phenotype caused by p.Cys5Trp mutation in THAP1 gene.
Jurek M, et.al
Neurologia i Neurochirurgia Polska, 48(4), 254-257 (2014)
Interaction between variants of two glycosyltransferase genes in IgA nephropathy.
Zhu L, et.al
Kidney International, 76(2), 190-198 (2009)
Screening for THAP1 Mutations in Polish Patients with Dystonia Shows Known and Novel Substitutions.
Golanska E
PLoS ONE, 10(6), e0129656-e0129656 (2015)
Marta Jurek et al.
Neurologia i neurochirurgia polska, 48(4), 254-257 (2014-08-30)
Mutations localized in THAP1 gene, locus 18p11.21 have been reported as causative of primary dystonia type 6 (DYT6). Disease which is characterized mainly by focal dystonia, frequently involving the craniocervical region, however associated also with early-onset generalized dystonia and spasmodic
Li Zhu et al.
Kidney international, 76(2), 190-198 (2009-04-10)
Increasing evidence points to the importance of aberrant O-glycosylated immunoglobulin A1 (IgA1) in the pathogenesis of IgA nephropathy (IgAN), a disease widely considered to be a polygenic disorder. We earlier found that haplotypes in two key glycosyltransferase genes, C1GALT1 and

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique