Accéder au contenu
Merck
Toutes les photos(6)

Principaux documents

WH0006241M1

Sigma-Aldrich

Monoclonal Anti-RRM2 antibody produced in mouse

clone 1E1, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Rrm2 Antibody, Rrm2 Antibody - Monoclonal Anti-RRM2 antibody produced in mouse, Anti-R2, Anti-RR2M, Anti-ribonucleotide reductase M2 polypeptide

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μG
489,00 €

489,00 €


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.


Sélectionner une taille de conditionnement

Changer de vue
100 μG
489,00 €

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

489,00 €


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

1E1, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
immunoprecipitation (IP): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

Isotype

IgG1κ

Numéro d'accès GenBank

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... RRM2(6241)

Description générale

The ribonucleotide reductase regulatory subunit M2 (RRM2) gene is located on the human chromosome at 2p25.1. RRM2 protein is a component of ribonucleotide reductase (RR). This protein is a dimer and each dimer consists of tyrosine free-radical and non-heme iron.

Immunogène

RRM2 (NP_001025, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLS

Application

Monoclonal Anti-RRM2 antibody produced in mouse has been used in:
  • immunohistochemistry
  • western blotting
  • immunofluorescence

Actions biochimiques/physiologiques

Ribonucleotide reductase regulatory subunit M2 (RRM2) protein regulates the activity of ribonucleotide reductase (RR) during the G1/early S phase of the cell cycle when DNA replication takes place. This protein provides the essential precursors for DNA synthesis. RRM2 protein catalyzes the biogenesis of deoxyribonucleotides from their corresponding ribonucleotides. RRM2 protein acts as a biomarker for various human cancers. Overexpression of RRM2 gene is observed during tumor progression, cellular response to DNA damage and increased cellular invasiveness.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

A novel protein-based prognostic signature improves risk stratification to guide clinical management in early-stage lung adenocarcinoma patients
Martinez T E, et al.
The Journal of Pathology, 245(4), 421-432 (2018)
Potent siRNA inhibitors of ribonucleotide reductase subunit RRM2 reduce cell proliferation in vitro and in vivo
Heidel J D, et al.
Current Rheumatology Reports, 13(7), 2207-2215 (2007)
RRM2 induces NF-kappaB-dependent MMP-9 activation and enhances cellular invasiveness
Duxbury M S and Whang E E
Biochemical and biophysical research communications, 354(1), 190-196 (2007)
Systemic delivery of siRNA nanoparticles targeting RRM2 suppresses head and neck tumor growth
Rahman M A, et al.
Journal of Controlled Release : Official Journal of the Controlled Release Society, 159(3), 384-392 (2012)
Presence of 2p25. 3 Duplication and 2q37. 3 Microdeletion Syndrome in the Same Individual
Moreno L J, et al.
2016 Oncology Nursing Drug Handbook, 27(2), 73-84 (2019)

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique