Accéder au contenu
Merck
Toutes les photos(4)

Principaux documents

WH0005728M1

Sigma-Aldrich

Monoclonal Anti-PTEN antibody produced in mouse

clone 2G9, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-BZS, Anti-MGC11227, Anti-MHAM, Anti-MMAC1, Anti-PTEN1, Anti-TEP1, Anti-phosphatase and tensin homolog (mutated in multiple advanced cancers 1)

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μG
489,00 €

489,00 €


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.
Un anticorps recombinant, sans conservateur, est disponible pour votre cible. Essayez ZRB1504


Sélectionner une taille de conditionnement

Changer de vue
100 μG
489,00 €

About This Item

Numéro MDL:
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

489,00 €


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.
Un anticorps recombinant, sans conservateur, est disponible pour votre cible. Essayez ZRB1504

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

2G9, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

indirect ELISA: suitable
proximity ligation assay: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès GenBank

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... PTEN(5728)

Description générale

Phosphatase and tensin homolog (PTEN) is a tumor-suppressor gene. It encodes for a phosphatase which possesses a tensin-like domain, a catalytic domain and a 220-amino acid carboxy-terminal region. The PTEN gene is localized on human chromosome 10q23.3.

Immunogène

PTEN (AAH05821, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTL

Application

Monoclonal Anti-PTEN antibody produced in mouse has been used in Western Blotting.

Actions biochimiques/physiologiques

Phosphatase and tensin homolog (PTEN) is a negative regulator of the phosphoinositide 3-kinase (PI3K) pathway. It de-phosphorylates phosphatidylinositol-[3, 4, 5]-tri-phosphate (PIP3). PTEN also has roles in cell growth, proliferation, control of cell cycle and apoptosis. It has been associated with gastric and breast cancers.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Phytochemical profile and apoptotic activity of Onopordum cynarocephalum
Formisano, Carmen, et al
Planta Medica (2012)
Crystal Structure of the PTEN Tumor Suppressor: Implications for Its Phosphoinositide Phosphatase Activity and Membrane Association
Jie-Oh Lee
Cell (1999)
The prognostic value and potential drug target of phosphatase and tensin homolog in breast cancer patients: A meta-analysis.
Medicine (2017)
Phosphatase and tensin homolog (PTEN) expression on oncologic outcome in renal cell carcinoma: A systematic review and meta-analysis.
Tang L
PLoS ONE (2017)
PTEN Gene Induces Cell Invasion and Migration via Regulating AKT/GSK-3?/?-Catenin Signaling Pathway in Human Gastric Cancer.
Ma J.al
Digestive Diseases and Sciences (2017)

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique