Accéder au contenu
Merck
Toutes les photos(1)

Documents

SAB2108439

Sigma-Aldrich

Anti-TUBB6 antibody produced in rabbit

affinity isolated antibody

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

50kDa

Espèces réactives

rabbit, human, horse, bovine, pig, dog

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunoblotting: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... TUBB6(84617)

Description générale

Tubulin, β 6 class V (TUBB6) is encoded by a multigene family.It is located on human chromosome 18p11.21.

Immunogène

Synthetic peptide directed towards the N terminal region of human TUBB6

Actions biochimiques/physiologiques

Tubulin, β 6 class V (TUBB6) expression expression is correlated with microtubule stability. TUBB6 expression decreases in most tumors. Mutation in TUBB6 leads to velopharyngeal dysfunction, bilateral ptosis and congenital non-progressive facial palsy.Increased production of TUBB6 causes complete disruption of microtubule network and lowers pyroptosis.

Séquence

Synthetic peptide located within the following region: QLERINVYYNESSSQKYVPRAALVDLEPGTMDSVRSGPFGQLFRPDNFIF

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Outil de sélection de produits.

Code de la classe de stockage

12 - Non Combustible Liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

A cellular genome-wide association study reveals human variation in microtubule stability and a role in inflammatory cell death
Salinas,, et al.
Molecular Biology of the Cell, 25(1), 76-86 (2014)
Disease-associated epigenetic changes in monozygotic twins discordant for schizophrenia and bipolar disorder
Dempster,, et al.
Human Molecular Genetics, 20(24), 4786-4796 (2011)
A TUBB6 mutation is associated with autosomal dominant non-progressive congenital facial palsy, bilateral ptosis and velopharyngeal dysfunction
Fazeli, W, et al.
Human Molecular Genetics, 26(20), 4055-4066 (2017)
Tumoral and tissue-specific expression of the major human beta-tubulin isotypes.
Leandro-Garcia LJ
Cytoskeleton (Hoboken, N.J.), 67(4), 214-223 (2010)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique