Accéder au contenu
Merck
Toutes les photos(2)

Principaux documents

SAB1402456

Sigma-Aldrich

Monoclonal Anti-OSMR antibody produced in mouse

clone 3E12, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

MGC150626, MGC150627, MGC75127, OSMRB

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μG
416,00 €

416,00 €


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.


Sélectionner une taille de conditionnement

Changer de vue
100 μG
416,00 €

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

416,00 €


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

3E12, monoclonal

Forme

buffered aqueous solution

Poids mol.

antigen ~37.11 kDa

Espèces réactives

human

Technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2bκ

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... OSMR(9180)

Description générale

Oncostatin M receptor (OSMR) is a cell surface cytokine receptor. Oncostatin M and interleukin-31 are its ligands. The gene encoding this protein is localized on human chromosome 5p.

Immunogène

OSMR (NP_003990.1, 141 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKGIVLFVSKVLEEP

Actions biochimiques/physiologiques

Oncostatin M receptor (OSMR) acts as an activator of janus kinase/signal transducers and activators of transcription (JAK/STAT) and mitogen-activated protein kinase pathway. Thus, it has a role in stimulating cytokines and inflammatory substances. Mutation in the OSMR gene has been linked to primary localized cutaneous amyloidosis.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Overexpression of the oncostatin-M receptor in cervical squamous cell carcinoma is associated with epithelial-mesenchymal transition and poor overall survival.
Kucia-Tran JA
British Journal of Cancer (2016)
A novel missense mutation in oncostatin M receptor beta causing primary localized cutaneous amyloidosis.
Saeedi M
BioMed Research International (2014)
Association of OSMR gene polymorphisms with rheumatoid arthritis and systemic lupus erythematosus patients.
Lin YZ
Autoimmunity (2014)

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique