HPA030867

Anti-ADAM12 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-ADAM metallopeptidase domain 12, Anti-ERBB, Anti-ERBB1, Anti-MCMPMltna, Anti-MLTN
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA030867
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Validation améliorée: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• Technique(s): immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:500-1:1000
• Séquence immunogène: LLFTNKKTTIEKLRCVRPSRPPRGFQPCQAHLGHLGKGLMRKPPDSYPPKDNPRRLLQCQNVDISRPLN
• Numéro d'accès UniProt: O43184
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... ADAM12(8038)

Description

Description générale

ADAM12 (metallopeptidase domain 12) gene is mapped in human chromosome 10q26.2. ADAM12 is highly expressed in placenta. The gene encodes for two variant proteins, a full-length membrane-bound isoform (ADAM12L) and a truncated secreted variant (ADAM12S).

Immunogène

ADAM metallopeptidase domain 12 recombinant protein epitope signature tag (PrEST)

Application

ADAM12 has been used to create antibody suspension bead array to study affinity-based profiling of serum and plasma by microarray assays.

All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Actions biochimiques/physiologiques

ADAM12 (metallopeptidase domain 12) is a metalloprotease disintegrin and catalyzes cell context-dependent cleavage of transmembrane receptors, growth factor precursors, or adhesion molecules. Abnormal expression of the gene is mostly observed in many human cancers including breast, colon, hepatocellular carcinomas, glioblastomas, stomach, oral cavity, bladder, lung and giant cell tumors of bone. ADAM12 might be associated with tumor progression, metastasis, or therapy resistance. The encoded protein serves as a marker for chemoresistance in estrogen receptor-negative tumors. ADAM12 has the ability to induce cancer stem cell phenotype in breast cancer cells. Increased expression of this gene is observed during epithelial-to-mesenchymal transition, associated with claudin-low breast tumors. Upregulation of the gene is observed in small cell lung cancer.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST77731

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable