HPA010831

Anti-PHF2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-GRC5, Anti-PHD finger protein 2
• Numéro MDL: MFCD03791931
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA010831
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Technique(s): immunohistochemistry: 1:200- 1:500
• Séquence immunogène: LEIREQTKSKSEAKWKYKNSKPDSLLKMEEEQKLEKSPLAGNKDNKFSFSFSNKKLLGSKALRPPTSPGVFGALQNFKEDKPKPVRDEYEYVSDDGELKIDEFPIRRKKNAPKRDLSFLLDKKAVLPTPVTKPKLD
• Numéro d'accès UniProt: O75151
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... PHF2(5253)

Description

Description générale

PHF2 (PHD finger protein 2) is a member of α-ketoglutarate-Fe²⁺-dependent dioxygenases. This family of proteins contains three members namely, PHF2, PHF8 and KIAA1718. PHF2 gene maps to human chromosome 9q22. It contains a Jumonji domain and a plant homeodomain (PHD) at its N-terminal. Its C-terminal contains four repeats of TPAST sequence, along with a serine and threonine rich sequence. It has two possible PEST sequences and eight putative nuclear localization signals. It is widely expressed in most adult tissues.

Immunogène

PHD finger protein 2 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Actions biochimiques/physiologiques

PHF2 (PHD finger protein 2) is a histone H3K9 demethylase that demethylates H3K9me1, and through its PHD (plant homeodomain) domain interacts with H3K4me3. Therefore, it regulates the demethylation of histone. However, it remains inactive unless phosphorylated by protein kinase A (PKA). Once activated, it forms a complex with a DNA-binding protein called ARID5B (AT rich interactive domain 5B). This causes demethylation of ARID5B, and PHF2- ARID5B complex then interacts with the target promoters. Hence, this complex regulates histone methylation and gene transcription. In mouse embryos, PHF2 is expressed in higher levels in neural tube and dorsal root ganglia, as opposed to its expression in other tissues. This expression profile suggests that PHF2 might have a role in hereditary sensory neuropathy type I (HSN1). This protein is found to be associated with many cancers, and its expression is up-regulated in esophageal squamous cell carcinoma (ESCC).

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST71317

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)