Accéder au contenu
Merck
Toutes les photos(4)

Documents

HPA005990

Sigma-Aldrich

Anti-SELP antibody produced in rabbit

enhanced validation

Ab2, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-CD62P antigen antibody produced in rabbit, Anti-GMP-140 antibody produced in rabbit, Anti-Granule membrane protein 140 antibody produced in rabbit, Anti-LECAM3 antibody produced in rabbit, Anti-Leukocyte-endothelial cell adhesion molecule 3 antibody produced in rabbit, Anti-P-selectin precursor antibody produced in rabbit, Anti-PADGEM antibody produced in rabbit

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(4)

About This Item

Numéro MDL:
MFCD02263996
Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
HPA005990
Nomenclature NACRES :
NA.43

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Validation améliorée

recombinant expression
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

Technique(s)

immunohistochemistry: 1:50-1:200
western blot: 0.04-0.4 μg/mL

Séquence immunogène

GSLDCSDTRGEFNVGSTCHFSCDNGFKLEGPNNVECTTSGRWSATPPTCKGIASLPTPGVQCPALTTPGQGTMYCRHHPGTFGFNTTCYFGCNAGFTLIGDSTLSCRPSGQWTAVTPACRAVKCSELHVNKPIAMNCSNLW

Numéro d'accès UniProt

P16109

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SELP(6403)

Vous recherchez des produits similaires ? Visite Guide de comparaison des produits

Immunogène

P-selectin precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Actions biochimiques/physiologiques

P-selectin is a protein encoded by the SELP gene in humans. It is referred to as CD62, GRMP, PSEL, CD62P, GMP140, LECAM3 and PADGEM. This protein on endothelial cell surfaces is important for impaired microvascular blood flow in sickle cell disease (SCD). Polymorphisms of this gene is associated with serum sP-selectin levels or thromboembolic events. Overexpression of this gene in patients with inflammatory bowel disease can be used as a criterion of disease pathogenesis.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST83065

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Abdullah Kutlar et al.
Hematology/oncology clinics of North America, 28(2), 323-339 (2014-03-05)
P-selectin on endothelial cell surfaces is central to impaired microvascular blood flow in sickle cell disease (SCD). Restoration of blood flow is expected to provide therapeutic benefit for SCD patients, whatever the mechanism of action of the treatment. Long-term oral
Ling Bai et al.
Biochemical and biophysical research communications, 452(3), 303-307 (2014-08-05)
To investigate the association between the polymorphism of P choose element (p. selectin, PS) and soluble P-selectin levels in atrial fibrillation (AF) thromboembolism in Han and Uigur population of Xinjiang. Using ELISA method determination of plasma level of sPs. The
Y Tekelioglu et al.
Bratislavske lekarske listy, 115(2), 83-85 (2014-03-08)
There is an increased risk of thromboembolic complications in inflammatory bowel disease. Activated platelets play a crucial role in the pathogenesis of this disease. To evaluate platelet activation in inflammatory bowel disease. This study comprised 20 healthy control subjects and
Jermaine Goveia et al.
Cancer cell, 37(1), 21-36 (2020-01-15)
Heterogeneity of lung tumor endothelial cell (TEC) phenotypes across patients, species (human/mouse), and models (in vivo/in vitro) remains poorly inventoried at the single-cell level. We single-cell RNA (scRNA)-sequenced 56,771 endothelial cells from human/mouse (peri)-tumoral lung and cultured human lung TECs, and detected

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique