Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

AV49203

Sigma-Aldrich

Anti-POLQ antibody produced in rabbit

affinity isolated antibody, lyophilized powder

Synonyme(s) :

Anti-Polymerase (DNA directed), theta

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Le tarif et la disponibilité ne sont pas disponibles actuellement.

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

lyophilized powder

Espèces réactives

bovine, mouse, rat, human

Technique(s)

western blot: suitable

Séquence immunogène

SFSFTSSDDIAEVLFLELKLPPNREMKNQGSKKTLGSTRRGIDNGRKLRL

Numéro d'accès NCBI

NP_955452

Numéro d'accès UniProt

O75417

Température de stockage

−20°C

Informations sur le gène

human ... POLQ(10721)

Immunogène

synthetic peptide corresponding to a region of human POLQ with an internal ID of S24206

Application

Anti-POLQ antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Actions biochimiques/physiologiques

Polymerase (DNA directed), theta (POLQ) is a DNA polymerase and helicase involved in base excision repair and maintenance of genomic instability against ionizing radiations.[1] Loss of POLQ activity results in increased DNA damage signaling whereas increased activity indicates poor cancer prognosis.[2]

Forme physique

Lyophilized from PBS buffer with 2% sucrose

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

13 - Non Combustible Solids

Classe de danger pour l'eau (WGK)

WGK 2

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number
QC20139

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Rechercher un(e) COA

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Matthew J Yousefzadeh et al.
DNA repair, 12(1), 1-9 (2012-12-12)
In mammalian cells, POLQ (pol θ) is an unusual specialized DNA polymerase whose in vivo function is under active investigation. POLQ has been implicated by different experiments to play a role in resistance to ionizing radiation and defense against genomic
Tatiana Kent et al.
Nature structural & molecular biology, 22(3), 230-237 (2015-02-03)
Microhomology-mediated end-joining (MMEJ) is an error-prone alternative double-strand break-repair pathway that uses sequence microhomology to recombine broken DNA. Although MMEJ has been implicated in cancer development, the mechanism of this pathway is unknown. We demonstrate that purified human DNA polymerase
Geoff S Higgins et al.
Oncotarget, 1(3), 175-184 (2010-08-12)
Depletion of POLQ (DNA polymerase theta) has recently been shown to render tumour cells more sensitive to radiotherapy whilst having little or no effect on normal tissues. This finding led us to investigate whether tumours that overexpress POLQ are associated

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique