Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

AV49036

Sigma-Aldrich

Anti-GSTZ1 antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-GSTZ1-1, Anti-Gutathione transferase zeta 1 (maleylacetoacetate isomerase), Anti-MAAI, Anti-MAI, Anti-MGC2029

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μL
287,00 €

287,00 €


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.


Sélectionner une taille de conditionnement

Changer de vue
100 μL
287,00 €

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

287,00 €


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

24 kDa

Espèces réactives

mouse, pig, bovine, human, dog, rabbit, horse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... GSTZ1(2954)

Immunogène

Synthetic peptide directed towards the N terminal region of human GSTZ1

Application

Anti-GSTZ1 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.

Actions biochimiques/physiologiques

Glutathione S-transferase zeta 1 (GSTZ1) belongs to glutathione S-transferase (GSTs) super-family involved in detoxification of carcinogens and drugs by conjugation with glutathione. GSTZ1 is also involved in the metabolism of phenylalanine and tyrosine. Defects in GSTZ1 gene result in metabolic disorders such as phenylketonuria, alkaptonuria and tyrosinaemia.

Séquence

Synthetic peptide located within the following region: MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDF

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

G Polekhina et al.
Biochemistry, 40(6), 1567-1576 (2001-05-01)
Maleylacetoacetate isomerase (MAAI), a key enzyme in the metabolic degradation of phenylalanine and tyrosine, catalyzes the glutathione-dependent isomerization of maleylacetoacetate to fumarylacetoacetate. Deficiencies in enzymes along the degradation pathway lead to serious diseases including phenylketonuria, alkaptonuria, and the fatal disease
Li Yin et al.
Journal of molecular recognition : JMR, 26(1), 38-45 (2013-01-03)
Accumulating evidence shows that glutathione peroxidase (GPX, EC.1.11.1.9), one of the most important antioxidant selenoenzymes, plays an essential role in protecting cells and tissues against oxidative damage by catalyzing the reduction of hydrogen peroxide by glutathione. Unfortunately, because of the

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique