Accéder au contenu
Merck
Toutes les photos(1)

Documents

AV48999

Sigma-Aldrich

Anti-NEK7 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-NIMA (never in mitosis gene a)-related kinase 7

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

34 kDa

Espèces réactives

rat, human, mouse, dog, guinea pig, bovine, horse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_598001

Numéro d'accès UniProt

Q8TDX7

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... NEK7(140609)

Immunogène

Synthetic peptide directed towards the N terminal region of human NEK7

Application

Anti-NEK7antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Actions biochimiques/physiologiques

NIMA-related kinase 7 (NEK7), a serine/threonine protein kinase is required for the proper formation of spindle during mitosis. NEK7 recruits centrosomal pericentriolar material (PCM) proteins which are required for centriole duplication and spindle pole formation. Optimum activity of NEK7 is necessary for cell cycle progression during M and G1 phase and during cytokinesis.

Séquence

Synthetic peptide located within the following region: KARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMI

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Nek9, Nek6, Nek7 and the separation of centrosomes.
Sara Sdelci et al.
Cell cycle (Georgetown, Tex.), 10(22), 3816-3817 (2011-11-09)
Sunghwan Kim et al.
Journal of cell science, 124(Pt 22), 3760-3770 (2011-11-22)
The centrosomes in dividing cells follow a series of cyclical events of duplication and separation, which are tightly linked to the cell cycle. Serine/threonine-protein kinase NEK7 (NEK7) is a centrosomal kinase that is required for proper spindle formation during mitosis.
Laura O'Regan et al.
Molecular and cellular biology, 29(14), 3975-3990 (2009-05-06)
Nek6 and Nek7 are members of the NIMA-related serine/threonine kinase family. Previous work showed that they contribute to mitotic progression downstream of another NIMA-related kinase, Nek9, although the roles of these different kinases remain to be defined. Here, we carried

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique