Accéder au contenu
Merck
Toutes les photos(1)

Documents

AV43761

Sigma-Aldrich

Anti-SLC25A25 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-KIAA1896, Anti-MCSC, Anti-MGC105138, Anti-PCSCL, Anti-SCAMC-2, Anti-Solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

55 kDa

Espèces réactives

horse, human, bovine, dog, rabbit, guinea pig, rat, mouse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_001006642

Numéro d'accès UniProt

Q6KCM6

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SLC25A25(114789)

Immunogène

Synthetic peptide directed towards the N terminal region of human SLC25A25

Actions biochimiques/physiologiques

SLC25A25 is a member of family of calcium-binding mitochondrial carriers located in the inner membranes of mitochondria. It is ATP-Mg/Pi carrier and regulates the movement of adenine nucleotides in mitochondria. SLC25A25 maintains the homeostasis of ATP and Ca+2 cycling in the skeletal muscle.

Séquence

Synthetic peptide located within the following region: AVGLRRLGLHRTEGELQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLV

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Araceli del Arco et al.
The Journal of biological chemistry, 279(23), 24701-24713 (2004-04-01)
Aralar1 and citrin were identified as calcium binding aspartate/glutamate carriers (AGC) in mitochondria. The presence of calcium binding motifs facing the extramitochondrial space allows the regulation of the transport activity of these carriers by cytosolic calcium and provides a new
Rea P Anunciado-Koza et al.
The Journal of biological chemistry, 286(13), 11659-11671 (2011-02-08)
An ATP-Mg(2+/)P(i) inner mitochondrial membrane solute transporter (SLC25A25), which is induced during adaptation to cold stress in the skeletal muscle of mice with defective UCP1/brown adipose tissue thermogenesis, has been evaluated for its role in metabolic efficiency. SLC25A25 is thought

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique