AV40225

Anti-EXOSC10 antibody produced in rabbit

IgG fraction of antiserum

• Synonyme(s) : Anti-Exosome component 10
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: IgG fraction of antiserum
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 97 kDa
• Espèces réactives: human
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): immunohistochemistry: suitable; western blot: suitable
• Numéro d'accès NCBI: NP_002676
• Numéro d'accès UniProt: Q01780
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... EXOSC10(5394)

Description

Description générale

Exosome complex (RNAse complex), a complex of 3′ -→ 5′ exoribonucleases, is a multi-protein complex that degrades various types of ribonucleic acids (RNA). Exosome component 10 (EXOSC10, PMSCL2, "polymyositis/scleroderma autoantigen 2, 100kDa) is an exoribonuclease that shares sequence similarity to budding yeast Rrp6 and is proposed to catalyze 3′-to-5′ exoribonuclease activity on a variety of nuclear transcripts including ribosomal RNA subunits, RNA that has been poly-adenylated by TRAMP, as well as other nuclear RNA transcripts destined for processing and/or destruction.

Spécificité

Anti-EXOSC10 polyclonal antibody reacts with human, mouse, rat, and bovine polymyositis/scleroderma autoantigen 2, 100kDa (Rrp6) proteins.

Immunogène

Synthetic peptide directed towards the C terminal region of human EXOSC10

Application

Anti-EXOSC10 polyclonal antibody is used to tag polymyositis/scleroderma autoantigen 2, 100kDa for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the possible roles of polymyositis/scleroderma autoantigen 2, 100kDa (Rrp6) in the function of specific exosomes.

Actions biochimiques/physiologiques

EXOSC10 contains 1 HRDC domain and 1 3′-5′ exonuclease domain. Antibodies against PM/SCL are found in patients with polymyositis and/or scleroderma.

Séquence

Synthetic peptide located within the following region: FAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRG

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable