Accéder au contenu
Merck
Toutes les photos(2)

Documents

AV34772

Sigma-Aldrich

Anti-UHRF2 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-Ubiquitin-like, containing PHD and Ring finger domains, 2

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

90 kDa

Espèces réactives

rabbit, human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

NP_690856

Numéro d'accès UniProt

Q96PU4

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... UHRF2(115426)

Description générale

UHRF2 is a ubiquitin E3 ligase that also functions as a SUMO E3 ligase for ZNF131. This E3 ligase has been implicated in the cell cycle network.
Rabbit Anti-UHRF2 antibody recognizes human, bovine, rat, canine, and mouse UHRF2.

Immunogène

Synthetic peptide directed towards the N terminal region of human UHRF2

Application

Rabbit Anti-UHRF2 antibody is suitable for western blot applications at a concentration of 0.5 μg/ml and for IHC (4-8 μg/ml).

Actions biochimiques/physiologiques

UHRF2 encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis.

Séquence

Synthetic peptide located within the following region: TNKLDSVPSTSNSDCVAADEDVIYHIQYDEYPESGTLEMNVKDLRPRART

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 2

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Tsutomu Mori et al.
FEBS letters, 586(11), 1570-1583 (2012-06-08)
As predicted by systems biology, a paradigm shift will emerge through the integration of information about different layers of cellular processes. The cell cycle network is at the heart of the cellular computing system, and orchestrates versatile cellular functions. The
Yohan Oh et al.
The Journal of biological chemistry, 288(13), 9102-9111 (2013-02-14)
Small ubiquitin-like modifier (SUMO), a member of the ubiquitin-related protein family, is covalently conjugated to lysine residues of its substrates in a process referred to as SUMOylation. SUMOylation occurs through a series of enzymatic reactions analogous to that of the

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique