Accéder au contenu
Merck
Toutes les photos(2)

Documents

AV33623

Sigma-Aldrich

Anti-CLDN1 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-Claudin 1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

23 kDa

Espèces réactives

human, dog, sheep, horse, bovine, guinea pig

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... CLDN1(9076)

Description générale

Claudin-1 (CLDN1) membrane protein belongs to the claudin family. It comprises four membrane-spanning regions, N- and C-terminal cytoplasmic domains, and two extracellular loops. The CLDN1 gene is mapped to human chromosome 3q28. It is expressed in the kidney, testis, intestine, brain, and liver.

Immunogène

Synthetic peptide directed towards the C terminal region of human CLDN1

Actions biochimiques/physiologiques

Claudin-1 (CLDN1) is a key component of the tight junctions that mediate epithelial barrier functions. CLDN1 is dichotomous as it is downregulated in breast, esophageal and prostate cancer. The gene is overexpressed in oral squamous cell cancer, colon, nasopharyngeal and ovarian tumors. It is implicated in neonatal sclerosing cholangitis (NISCH) syndrome. CLDN1 is involved in dengue (DENV) entry and acts as a co-receptor for hepatitis C virus (HCV) entry.

Séquence

Synthetic peptide located within the following region: GQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Ajaz A Bhat et al.
International journal of molecular sciences, 21(2) (2020-01-19)
Claudins, a group of membrane proteins involved in the formation of tight junctions, are mainly found in endothelial or epithelial cells. These proteins have attracted much attention in recent years and have been implicated and studied in a multitude of
Pulin Che et al.
Virology, 446(1-2), 303-313 (2013-10-01)
Dengue disease is becoming a huge public health concern around the world as more than one-third of the world's population living in areas at risk of infection. In an effort to assess host factors interacting with dengue virus, we identified
Anne A Blanchard et al.
PloS one, 11(9), e0163387-e0163387 (2016-09-21)
The claudin 1 tight junction protein, solely responsible for the barrier function of epithelial cells, is frequently down regulated in invasive human breast cancer. The underlying mechanism is largely unknown, and no obvious mutations in the claudin 1 gene (CLDN1)
Smail Hadj-Rabia et al.
Gastroenterology, 127(5), 1386-1390 (2004-11-03)
Most human and animal cholestatic disorders are associated with changes in hepatocyte cytoskeleton and tight junctions (TJs). These changes are usually secondary and nonspecific phenomena, both in intra- and extrahepatic cholestasis. Recently, missense mutations in TJ protein 2 (ZO-2) have

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique