Accéder au contenu
Merck
Toutes les photos(2)

Principaux documents

AV31500

Sigma-Aldrich

Anti-TCFL5 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-Transcription factor-like 5 (basic helix-loop-helix)

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

53 kDa

Espèces réactives

human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... TCFL5(10732)

Description générale

TCFL5 is a basic helix-loop-helix (bHLH) protein that is expressed in primary spermatocytes. Studies in mice have revealed that Tcfl5 associated with the Calmegin gene promoter during spermatogenesis.
Rabbit Anti-TCFL5 antibody recognizes mouse and human TCFL5.

Immunogène

Synthetic peptide directed towards the middle region of human TCFL5

Application

Rabbit Anti-TCFL5 antibody can be used for western blot assays at a concentration of 2.0μg/ml. The antibody product can also be used for IHC applications (4-8μg/ml, using paraffin-embedded tissues).

Actions biochimiques/physiologiques

TCFL5 is a new bHLH transcription factor that negatively regulates upstream transcription factor-dependent transcription.

Séquence

Synthetic peptide located within the following region: TLIRHPSELMNVPLQQQNKCTALVKNKTAATTTALQFTYPLFTTNACSTS

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

12 - Non Combustible Liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

O Maruyama et al.
Cytogenetics and cell genetics, 82(1-2), 41-45 (1998-10-09)
We have isolated a novel human gene that is expressed specifically in primary spermatocytes in the testis. The cDNA contains an open reading frame of 1356 bp, encoding a 452-amino-acid protein that includes a basic Helix-Loop-Helix (bHLH) motif. The gene
Michel Siep et al.
Nucleic acids research, 32(21), 6425-6436 (2004-12-09)
In mouse spermatogenesis, differentiating germ line cells initiate expression of specific genes at subsequent developmental steps. The Calmegin (Clgn) gene is first expressed in meiotic prophase, in primary spermatocytes, and encodes a protein that acts as a chaperone. To identify

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique