Skip to Content
Merck
All Photos(4)

Key Documents

HPA042012

Sigma-Aldrich

Anti-CELF5 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Brunol5, Anti-Cugbp, elav-like family member 5

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
€540.00

€540.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
€540.00

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

€540.00


Please contact Customer Service for Availability

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:50- 1:200

immunogen sequence

AFSPCHIQQIGAVSLNGLPATPIAPASGLHSPPLLGTTAVPGLVAPITNGFAGVVPFPGGHPALETVYAN

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CELF5(60680)

General description

CUGBP Elav-like family member 5 (CELF5) belongs to CUG-BP, Elav-like family (CELF) family. It is highly expressed in brain. The gene is located on human chromosome 19p13.3. The protein consists of two N-terminal RNA recognition motif (RRM) domains and one C-terminal RRM domain separated by a divergent domain.

Immunogen

CUGBP, Elav-like family member 5 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

CUG-BP, Elav-like family (CELF) proteins is involved in regulating cytidine to uridine RNA editing, deadenylation, mRNA decay, and translation, gametogenesis and early embryonic development, heart and skeletal muscle function and neurosynaptic transmission. CUGBP Elav-like family member 5 (CELF5) controls cell-specific alternative splicing during normal development and disease.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST82761

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

The importance of CELF control: molecular and biological roles of the CUG-BP, Elav-like family of RNA-binding proteins
Dasgupta T and Ladd AN
Wiley Interdisciplinary Reviews. RNA, 3(1), 104-121 (2012)
RNA-binding proteins in heart development
Systems Biology of RNA Binding Proteins, 389-429 (2014)
CUG-BP, Elav-like family (CELF)-mediated alternative splicing regulation in the brain during health and disease
Ladd AN
Molecular and Cellular Neurosciences, 56(8), 456-464 (2013)
Leila Cabral de Almeida Cardoso et al.
PloS one, 10(8), e0136812-e0136812 (2015-09-01)
Wilms tumor (WT), the most common cancer of the kidney in infants and children, has a complex etiology that is still poorly understood. Identification of genomic copy number variants (CNV) in tumor genomes provides a better understanding of cancer development
A N Ladd et al.
Molecular and cellular biology, 21(4), 1285-1296 (2001-02-07)
Alternative splicing of cardiac troponin T (cTNT) exon 5 undergoes a developmentally regulated switch such that exon inclusion predominates in embryonic, but not adult, striated muscle. We previously described four muscle-specific splicing enhancers (MSEs) within introns flanking exon 5 in

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service